ESTScan Details for Unigene SGN-U343233

Score 
147
Direction 
Forward
Predicted Peptide Sequence 
GAPRGGGRSRTSGSPGLQELARALALLQFKNMFTVNPDASYYCEFSHPKTRSWNKSTDCCSWDGVHCDNTTGQVIELDLRCSQLLGKLHS
NSSLFQLSNLKRLDLAYNEFTGSAISPKFGEFSNLTHLDLVESNFTGIIPSEISHPSKXIRSAVPPMINHMGXKPGPHHFEMPPKNLTPL
IKLRLYQGDLPFDIASNFPSPLTXSNGWLTIVNVDYCPKNPSTFQLKNPWIIRSFPXLAVRFRATYWISSASLVNLYLAGVNIADTIPES
FSHLTALHKLHMGYTSLSGPIRKPLLDLTHV
Predicted Coding Sequence 
XXTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTGGCACGAGCTCTTGCTCTTCTACAGTTC
AAGAACATGTTTACCGTTAATCCTGATGCTTCTTATTATTGTGAGTTTTCTCATCCAAAAACTCGTTCCTGGAACAAGAGCACAGATTGT
TGCTCATGGGATGGAGTTCATTGTGACAATACAACAGGACAAGTAATTGAGCTTGATCTCCGTTGCAGCCAACTTCTAGGCAAGCTTCAT
TCCAATAGTAGCCTCTTTCAACTCTCCAATCTCAAAAGACTTGATTTGGCTTATAATGAATTCACTGGATCGGCCATTTCACCTAAATTT
GGTGAGTTTTCAAATTTGACGCATCTTGATTTGGTTGAATCTAATTTTACCGGTATTATCCCTTCCGAAATTTCTCATCCTTCTAAAXCT
ATAAGGTCTGCXGTACCTCCAATGATTAACCATATGGGGTTXAAGCCTGGGCCTCACCATTTTGAAATGCCCCCTAAGAACTTGACCCCA
TTAATAAAGCTCCGCCTTTACCAAGGGGACCTCCCCTTCGACATTGCTTCCAATTTCCCCTCCCCTTTAACCAAXTCTAACGGTTGGCTT
ACCATAGTTAACGTGGATTATTGCCCAAAAAATCCTTCCACTTTTCAGCTTAAAAATCCTTGGATTATTCGTTCATTCCCCAXGCTCGCG
GTAAGGTTTCGCGCTACCTATTGGATTAGCAGTGCATCACTCGTGAATTTATATCTCGCTGGTGTGAATATAGCTGATACGATACCTGAA
TCATTTAGCCATCTAACTGCACTTCATAAGCTGCACATGGGTTATACTAGTCTGTCAGGGCCCATTCGTAAACCTCTATTGGATCTCACC
CACGTN
Edits in Original Sequence 
(5')XXTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTcGGCACGAGCTCTTGCTCTTCTAC
AGTTCAAGAACATGTTTACCGTTAATCCTGATGCTTCTTATTATTGTGAGTTTTCTCATCCAAAAACTCGTTCCTGGAACAAGAGCACAG
ATTGTTGCTCATGGGATGGAGTTCATTGTGACAATACAACAGGACAAGTAATTGAGCTTGATCTCCGTTGCAGCCAACTTCTAGGCAAGC
TTCATTCCAATAGTAGCCTCTTTCAACTCTCCAATCTCAAAAGACTTGATTTGGCTTATAATGAATTCACTGGATCGGCCATTTCACCTA
AATTTGGTGAGTTTTCAAATTTGACGCATCTTGATTTGGTTGAATCTAATTTTACCGGTATTATCCCTTCCGAAATTTCTCATCCTTCTA
AAXCTATAAGGTCTGCXGTACCTCCAATGATTAACCATATGGGGTTXAAGCCTGGGCCTCACCATTTTGAAATGCCCCCTAAGAACTTGA
CCCCATTAATAAAGCTCCGCCTTTACCAAGGGGACCTCCCCTTCGACATTGCTTCCAATTTCCCCTCCCCTTTAACCAAXTCTAACGGTT
GGCTTACCATAGTTAACGTGGATTATTGCCCAAAAAATCCTTCCACTTTTCAGCTTAAAAATCCTTGGATTATTCGTTCATTCCCCAXGC
TCGCGGTAAGGTTTCGCGCTACCTATTGGATTAGCAGTGCATCACTCGTGAATTTATATCTCGCTGGTGTGAATATAGCTGATACGATAC
CTGAATCATTTAGCCATCTAACTGCACTTCATAAGCTGCACATGGGTTATACTAGTCTGTCAGGGCCCATTCGTAAACCTCTATTGGATC
TCACCCACGTN(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan