ESTScan Details for Unigene SGN-U343235

Score 
251
Direction 
Reverse
Predicted Peptide Sequence 
SLGLSYLKCXXGSPALNASLQREQVSLADWALHCHRKNTTKELMDPHIKGEIIEECLKQFIDTAVSCLSDHGTDRPSMGSVLWNLEYCLQ
LQSDPDEPKMVAEQKANDAYAMHKELLTVAEEGKESAEDSTDTVFSQIVNPQGR
Predicted Coding Sequence 
XGCTCTTTGGGGTTGTCCTATTTGAAGTGTNGTXCTGGAAGCCCAGCTCTAAATGCTAGTCTCCAAAGGGAACAAGTCAGTCTAGCAGAT
TGGGCATTACACTGCCATAGGAAAAATACTACCAAGGAACTTATGGATCCACATATTAAAGGGGAGATTATAGAAGAATGTCTGAAGCAA
TTCATCGATACAGCAGTGAGTTGTTTGTCTGATCACGGAACTGATCGTCCTTCAATGGGTTCAGTGCTGTGGAATCTTGAGTACTGCCTT
CAGTTGCAAAGTGATCCCGATGAACCAAAAATGGTGGCGGAACAGAAAGCTAATGATGCCTATGCTATGCATAAAGAGTTGTTAACGGTT
GCAGAAGAAGGTAAGGAGTCAGCAGAGGACAGCACGGACACTGTCTTCTCACAAATTGTAAATCCACAAGGTAGATAG
Edits in Original Sequence 
(5')XGCTCTTTGGGGTTGTCCTATTTGAAGTGTNGTXCTGGAAGCCCAGCTCTAAATGCTAGTCTCCAAAGGGAACAAGTCAGTCTAGC
AGATTGGGCATTACACTGCCATAGGAAAAATACTACCAAGGAACTTATGGATCCACATATTAAAGGGGAGATTATAGAAGAATGTCTGAA
GCAATTCATCGATACAGCAGTGAGTTGTTTGTCTGATCACGGAACTGATCGTCCTTCAATGGGTTCAGTGCTGTGGAATCTTGAGTACTG
CCTTCAGTTGCAAAGTGATCCCGATGAACCAAAAATGGTGGCGGAACAGAAAGCTAATGATGCCTATGCTATGCATAAAGAGTTGTTAAC
GGTTGCAGAAGAAGGTAAGGAGTCAGCAGAGGACAGCACGGACACTGTCTTCTCACAAATTGTAAATCCACAAGGTAGATAG(3')GTCA
ATACTAGCAATTATGAAGAGAGTTTATAATTGACCATGAAGCTTGCTTAGCTTGTACAGCACCTTCATTTCCAACAGGTAGGTTGGGTGT
TCGAGTCATGTGGATGGTACATGGAAGTACTAATAATCCTCCTAGACTGGGGGTGGAAAAAAAATACACTTGTAGCTTGTACCTCTGTTA
TTCTTAGTGCCTTCATTATTGCTTCCCTGCGAGTGAAGCATGTTCAATGTTATAGCTGCACTGCTTATGGTTAGCACAAGTCTTATTTTC
TAAGACTGAATCTCTATTTGGTCCGCGTTATTATTCAAGAAAGTAAACAGATAAACTAGTAGAACAATTTACAATCGAATAAACAAATTG
GTTATAT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan