ESTScan Details for Unigene SGN-U343252

Score 
181
Direction 
Reverse
Predicted Peptide Sequence 
QEKEEEVSPMISGQPVFMGYGCGLVIGLSVINIMWATQNPAWFSRRDVKLEPIISSENEKAQEKILVSSSLQDSKTSEFQVAGEA
Predicted Coding Sequence 
CAAGAAAAAGAAGAAGAAGTTTCCCCAATGATCAGTGGGCAACCAGTTTTCATGGGTTATGGTTGTGGCCTTGTTATTGGACTATCCGTA
ATAAACATAATGTGGGCAACCCAAAATCCAGCATGGTTTTCCAGGAGGGATGTAAAATTGGAACCCATTATTTCTTCXGAGAATGAAAAA
GCCCAAGAAAAGATTTTAGTGAGTAGTTCCCTCCAGGATTCAAAAACTTCCGAGTTCCAAGTTGCTGGGGAAGCA
Edits in Original Sequence 
(5')CAAGAAAAAGAAGAAGAAGTTTCCCCAATGATCAGTGGGCAACCAGTTTTCATGGGTTATGGTTGTGGCCTTGTTATTGGACTATC
CGTAATAAACATAATGTGGGCAACCCAAAATCCAGCATGGTTTTCCAGGAGGGATGTAAAATTGGAACCCATTATTTCTTCXGAGAATGA
AAAAGCCCAAGAAAAGATTTTAGTGAGTAGTTCCCTCCAGGATTCAAAAACTTCCGAGTTCCAAGTTGCTGGGGAAGCA(3')AACATTG
TATTTTTTTCAACTCTTTCGGCACATGAAATCAAAAAACCCTCCCCTTTATTTTAAAAAACCCG

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan