ESTScan Details for Unigene SGN-U343255

Score 
-243
Direction 
Forward
Predicted Peptide Sequence 
IAGAPRGGGRSRTSGSPXAAGSNGSINSYSIPILLATKGDIYDKVEPGSINVYTLRENSDNIPVITLGDTPDPAYYQSIYTVRGTARTGS
STTSSTMACWRLNTLPRGRIATEENEPATDPVGCAIPPAXTSKVTLPHSMALTAARKTPPVANDIPQDGTYHNENTEAKVASTGSNSCPS
VTLTPRALPASEYPIRSNPLPMKRGGALCAGWEENLTCYSRGGPVPNSPYSESYYIHWPSFYNVVTGKPWRYPTKSLAAHPLSPAGXNSE
EAPHDRPFPQCAA
Predicted Coding Sequence 
XXCATAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGXGGCTGCAGGCTCAAATGGTTCTATCAACTCATAC
TCTATTCCGATCCTACTAGCAACAAAGGGAGATATATATGATAAGGTGGAACCTGGGTCTATCAATGTATACACACTTCGGGAGAATAGT
GATAATATACCTGTGATCACATTAGGTGACACCCCTGATCCTGCCTATTATCAAAGCATATATACGGTTCGAGGCACTGCTAGAACTGGA
AGCTCCACCACGTCCTCTACCATGGCCTGCTGGCGCCTGAATACCCTGCCCCGTGGGCGCATAGCCACAGAAGAAAATGAACCAGCAACG
GACCCTGTAGGCTGTGCCATACCACCTGCAXCTACCTCTAAGGTGACACTCCCTCATAGTATGGCCCTGACGGCCGCAAGAAAAACACCA
CCTGTAGCCAACGACATTCCCCAGGATGGGACTTACCACAATGAGAACACTGAGGCAAAGGTGGCCTCGACTGGCTCAAACTCCTGCCCA
TCTGTGACCCTAACCCCTAGAGCTCTGCCAGCTTCTGAATATCCCATACGATCGAACCCCCTACCCATGAAACGTGGGGGTGCACTCTGT
GCTGGCTGGGAAGAAAATCTAACATGCTACTCGAGGGGGGGCCCGGTACCCAATTCGCCCTATAGTGAGTCGTATTACATTCACTGGCCG
TCGTTTTACAACGTCGTGACTGGGAAACCCTGGCGTTACCCAACTAAATCGCTTGCAGCACATCCCCTTTCGCCAGCTGGCXGTAATAGC
GAAGAGGCCCCGCACGATCGCCCTTTCCCACAGTGCGCAGCCTGA
Edits in Original Sequence 
(5')XXCATAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGXGGCTGCAGGCTCAAATGGTTCTATCAACTC
ATACTCTATTCCGATCCTACTAGCAACAAAGGGAGATATATATGATAAGGTGGAACCTGGGTCTATCAATGTATACACACTTCGGGAGAA
TAGTGATAATATACCTGTGATCACATTAGGTGACAcCCCCTGATCCTGCCTATTAgTCAAAGCATATATACGGTTCGAGGCACTGCTAGA
ACTGGAAGCTCCACCACGTCCTCTACCATGGCCTGCTGGCGCCTGAATACCCTGCCCCGTaGGGCGCATAGCCACAGAAGAAAATGAACC
AGCAACGGACCCTGTAGGCTGTGCCATACCACCTGCAXCTACCTCTAAGGTGACACTCCCTCATAGTATGGCCCTGACGGCCGCAAGAAA
AACACgCACCTGTAGcCCAACGACATTCCCCAGGATGGGACTTACCACAATGAGAACACTGAGGCAAAGGTGGCCTCGACTGGCTCAAAC
TCCTGCCCATCTGTGACCCTAACgCCCTAGAGCTCTGaCCAGCTTCTGAATATCCCATACGATCGAACCCCCTACCCATGAAACGTGGGG
GTGCACTCTGTGCTGGCTGGGAAGAAAATCTAACATGCTACTCGAGGGGGGGCCCGGTACCCAATTCGCCCTATAGTGAGTCGTATTACA
TTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAACCCTGGCGTTACCCAACTAAATCGCTTGCAGCACATCCCCTTTCGCCAGCTG
GCXGTAATAGCGAAGAGGCCCCGCACGATCGCCCTTTCCCACAGTGCGCAGCCTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan