ESTScan Details for Unigene SGN-U343406

Score 
490
Direction 
Forward
Predicted Peptide Sequence 
IKAGSSTAVAGRSRTSGSPGLQEFGTREELLHTSELSPAELLAKALAKAAGYSEIKSRSLLSSMENCVTLLLGAGGPYFHLPLHIMFXRG
FLTEDKVESIKGLTLTADGKGAVFDVSADDLDTFLAGKNAQGVSLEVVTELPRLQEKDQQRGGRFGGGRGDRRNGGRFSEAEXGGGRGYG
NFGRRW
Predicted Coding Sequence 
XXCATAAAAGCTGGGAGCTCCACCGCGGTGGCNGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGGAGGAA
CTTCTACATACCTCTGAACTATCACCAGCTGAATTGCTTGCGAAGGCACTTGCCAAGGCAGCTGGCTACTCTGAGATCAAGAGTCGTTCG
CTTCTTTCTTCCATGGAGAACTGTGTTACTCTACTTCTTGGTGCGGGAGGCCCATATTTTCACCTTCCTTTGCATATAATGTTTXTGCGG
GGGTTCCTAACTGAGGACAAGGTTGAATCAATCAAAGGTCTTACTTTGACAGCAGATGGAAAGGGCGCAGTTTTTGATGTATCTGCTGAT
GACCTGGACACATTTCTAGCTGGGAAGAACGCACAAGGTGTAAGCTTAGAGGTAGTAACAGAACTGCCCCGGTTGCAAGAGAAAGATCAG
CAGAGAGGCGGAAGATTTGGTGGTGGTCGCGGTGACAGGAGAAATGGAGGTCGATTTTCTGAGGCAGAANGTGGTGGTGGGAGAGGTTAT
GGAAACTTTGGCCGTAGATGGTGA
Edits in Original Sequence 
(5')XXCATAAAAGCTGGGAGCTCCACCGCGGTGGCNGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGGA
GGAACTTCTACATACCTCTGAACTATCACCAGCTGAATTGCTTGCGAAGGCACTTGCCAAGGCAGCTGGCTACTCTGAGATCAAGAGTCG
TTCGCTTCTTTCTTCCATGGAGAACTGTGTTACTCTACTTCTTGaGTGCGGGAGGCCCATATTTTCACCTTCCTTTGCATATAATGTTTX
TGCGGGGGTTCCTAACTGAGGACAAGGTTGAATCAATCAAAGGTCTTACTTTGACAGCAGATGGAAAGGGCGCAGTTTTTGATGTATCTG
CTGATGACCTGGACACATTTCTAGCTGGGAAGAACGCACAAGGTGTAAGCTTAGAGGTAGTAACAGAACTGCCCCGGTTGCAAGAGAAAG
ATCAGCAGAGAGGCGGAAGATTTGGTGGTGGTCGCGGTGACAGGAGAAATGGAGGTCGATTTTCTGAGGCAGAANGTGGTGGTGGGAGAG
GTTATGGAAACTTTGGCCGTAGATGGTGA(3')TTGCGATGATGAAGAAAAAAAATGTATATTACGGCTGCTGTATATGGAATACTAACA
TTAGATTTTTCATATATAGGCTCAATTCACTTTTTTTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan