ESTScan Details for Unigene SGN-U343408

Score 
317
Direction 
Forward
Predicted Peptide Sequence 
MPHTHACSTLLNSLVKDGLTDTLWKIYKKMQKIGVLPNIYIYNVLMHACCKSGDVERADDLLREMEFKATLPDLYTYNTLISLYCKKGMH
YEALWCTIGWKEQEYXPDIVTYNSLIYSYCREGRMREAMRLFKEIKGSTTNLVTYTTLIDGYCTANNVAEALRLKGAMDTKGLYPGGVTY
NSNLSDIGDQGQMKDANILLIEINEKKSIPDNVIVXNFINGDWQNGDIEFSFKGKNKMLEGGLNPDPVFFQALIHGFCNAKNSMGPQ
Predicted Coding Sequence 
ATGCCCCATACACATGCTTGTTCTACCCTTCTGAATTCATTGGTCAAGGATGGGTTGACTGATACTTTGTGGAAAATTTACAAAAAGATG
CAAAAAATAGGGGTCCTTCCAAATATCTATATCTATAACGTGCTTATGCATGCCTGTTGTAAGTCTGGTGATGTAGAGCGGGCTGATGAT
TTATTGAGAGAAATGGAGTTTAAAGCTACACTGCCTGACCTTTACACTTATAACACATTGATATCATTGTACTGCAAGAAAGGCATGCAT
TATGAAGCTTTGTGGTGCACGATAGGATGGAAAGAGCAGGAGTATGXTCCTGATATTGTAACCTATAATTCCTTAATTTACAGTTACTGC
AGGGAAGGGAGGATGAGGGAGGCTATGAGACTTTTCAAGGAAATTAAAGGTTCTACGACTAACCTGGTTACTTACACCACATTGATAGAT
GGATATTGCACAGCCAACAATGTTGCTGAAGCTTTAAGATTGAAAGGCGCCATGGACACAAAGGGTTTGTATCCCGGGGGTGTTACTTAC
AACTCAAATCTTTCGGACATTGGTGACCAAGGCCAGATGAAAGATGCCAATATCCTTTTAATTGAGATTAATGAGAAAAAATCCATCCCT
GATAATGTGATTGTCAXCAATTTTATTAATGGTGACTGGCAAAACGGGGATATTGAATTTTCTTTTAAGGGGAAAAATAAAATGTTGGAA
GGGGGCCTAAACCCTGACCCXGTTTTCTTCCAAGCCCTCATTCATGGATTTTGTAACGCAAAGAACTCGATGGGGCCCCAATAA
Edits in Original Sequence 
GGAGTTTGTAAGCTTATGCCCCATACACATGCTTGTTCTACCCTTCTGAATTCATTGGTCAAGGATGGGTTGACTG(5')ATGCCCCATA
CACATGCTTGTTCTACCCTTCTGAATTCATTGGTCAAGGATGGGTTGACTGATACTTTGTGGAAAATTTACAAAAAGATGCAAAAAATAG
GGGTCCTTCCAAATATCTATATCTATAACGTGCTTATGCATGCCTGTTGTAAGTCTGGTGATGTAGAGCGGGCTGATGATTTATTGAGAG
AAATGGAGTTTAAAGCTACACTGCCTGACCTTTACACTTATAACACATTGATATCATTGTACTGCAAGAAAGGCATGCATTATGAAGCTT
TGTGcGTGCACGATAGGATGGAAAGAGCAGGAGTATGXTCCTGATATTGTAACCTATAATTCCTTAATTTACAGTTACTGCAGGGAAGGG
AGGATGAGGGAGGCTATGAGACTTTTCAAGGAAATTAAAGGTTCTACGACTAACCTGGTTACTTACACCACATTGATAGATGGATATTGC
ACAGCCAACAATGTTGCTGAAGCTTTAAGATTGAAAGGCGCCATGGACACAAAGGGTTTGTATCCCGGGGGTGTTACTTACAACTCAAAT
CTTTCGGACATTGtGTGACCAAGGCCAGATGAAAGATGCCAATATCCTTTTAATTGAGATTAATGAGaAAAAAATCCATCCCTGATAATG
TGATTGTCAXCAATTTTATTAATGGTGACTGGCAAAACGGGGATATTGAATTTTCTTTTAAGGGGAAAAATAAAATGTTGGAAGGGGGCC
TAAACCCTGACCCXGTTTTCTTCCAAGCCCTCATTCATGGATTTTGTAACGCAAAGAACTCGATGGGGCCCCAATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan