ESTScan Details for Unigene SGN-U343460

Score 
308
Direction 
Forward
Predicted Peptide Sequence 
GAPRGGGRSRTSGSPXAAGAIQDLSGLLDNFERKNKKAASTQSKSEQSESEAKQVPVLTGSNFNDICGEKTPVCVIGVFRSSKAKDKLEK
VLLSVSQKSLSRRQNTPYGSRDSVSYAVLDAVRQQSFLNAFDKSGYKSSDKVLLAYKPRKGKFAVYEGEITAENAESFISSVLSGDVQFS
NTRQKPVAKKKLGTNFSGNEQH
Predicted Coding Sequence 
XCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGXGGCTGCAGGGGCAATTCAAGATCTAAGTGGTTTACTGGAC
AATTTTGAAAGAAAAAATAAGAAGGCAGCTTCAACACAGAGTAAAAGTGAGCAGAGTGAGTCAGAGGCTAAGCAAGTACCGGTACTGACA
GGCTCTAATTTCAATGACATTTGTGGGGAGAAAACTCCTGTTTGTGTGATTGGTGTTTTCAGGTCATCTAAAGCAAAAGATAAACTAGAA
AAAGTTCTATTATCGGTCTCTCAAAAGTCATTATCAAGACGACAAAATACACCCTATGGCTCGAGAGATTCAGTTTCCTATGCAGTTTTA
GATGCAGTGAGGCAGCAGTCTTTCTTGAATGCATTTGACAAATCAGGATATAAATCATCAGACAAGGTCCTTCTTGCATACAAGCCGCGA
AAAGGTAAGTTTGCAGTTTATGAGGGAGAAATTACTGCTGAAAATGCAGAGAGTTTCATTAGCTCCGTTCTCAGTGGGGACGTACAATTT
TCCAACACCAGACAGAAACCTGTAGCAAAGAAAAAATTAGGAACCAACTTTAGTGGAAATGAACAACACTGA
Edits in Original Sequence 
(5')XCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGXGGCTGCAGGGGCAATTCAAGATCTAAGTGGTTTACT
GGACAATTTTGAAAGAAAAAATAAGAAGGCAGCTTCAACACAGAGTAAAAGTGAGCAGAGTGAGTCAGAGGCTAAGCAAGTACCGGTACT
GACAGGCTCTAATTTCAATGACATTTGTGGGGAGAAAACTCCTGTTTGTGTGATTGGTGTTTTCAGGTCATCTAAAGCAAAAGATAAACT
AGAAAAAGTTCTATTATCGGTCTCTCAAAAGTCATTATCAAGACGACAAAATACACCCTATGGCTCGAGAGATTCAGTTTCCTATGCAGT
TTTAGATGCAGTGAGGCAGCAGTCTTTCTTGAATGCATTTGACAAATCAGGATATAAATCATCAGACAAGGTCCTTCTTGCATACAAGCC
GCGAAAAGGTAAGTTTGCAGTTTATGAGGGAGAAATTACTGCTGAAAATGCAGAGAGTTTCATTAGCTCCGTTCTCAGTGGGGACGTACA
ATTTTCCAACACCAGACAGAAACCTGTAGCAAAGtAAAAAATTAGGAACCAACTTTAGTGGAAATGAACAACACTGA(3')GTAGCCCAT
CGTCATGAGCTGGAAGAAGTTGATTTAGCAGCAAAGTTGATTAACCTTTGGTGGAGTAGGGTTCT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan