ESTScan Details for Unigene SGN-U343466

Score 
368
Direction 
Forward
Predicted Peptide Sequence 
VPAVADALELVDPRAAGLYLVGTPIGNLEDITLRALRVLKSADVILSEDTRHSGKLLHYYNIKTPLLSQIYESQRAQVVLRKLQDGEIVA
LISDAGTPGISDPGMELAKLCAEKNIPVVPIPGPSAVVTALSASGLPTNEFSFVGFLPKHNSSEEGKADTFSKXNQPHKSSSFRLTSFLN
FLKEKGGPFWGPFX
Predicted Coding Sequence 
XXTGTTCCCGCCGTGGCTGACGCTCTAGAACTAGTGGATCCCCGGGCTGCAGGTTTGTATCTTGTTGGAACCCCAATTGGCAATCTTGAA
GATATTACTCTCAGGGCTTTGCGGGTCTTGAAATCAGCAGATGTGATTCTTTCAGAAGATACAAGGCATTCTGGAAAATTGCTGCACTAT
TATAACATTAAAACTCCTCTTTTATCACAAATTTACGAGTCTCAAAGAGCACAAGTGGTGCTGAGGAAATTACAAGATGGTGAAATTGTC
GCCCTGATCAGCGATGCTGGCACACCAGGCATCAGTGACCCTGGAATGGAACTGGCTAAGCTGTGTGCGGAAAAAAATATACCTGTTGTT
CCCATTCCTGGGCCTTCTGCTGTGGTAACTGCTCTTTCAGCCTCTGGCTTACCTACGAACGAGTTCTCATTTGTTGGTTTTCTTCCAAAA
CATAATTCTTCXGAGGAAGGAAAGGCTGATACTTTCAGCAAAXTGAATCAGCCACACAAATCTTCTTCATTTCGCCTCACAAGCTTTCTC
AATTTCTTGAAAGAAAAGGGGGGCCCTTTTTGGGGCCCCTTTTXX
Edits in Original Sequence 
(5')XXTGTTCCCGCCGTGGCTGACGCTCTAGAACTAGTGGATcCCCCGGGCTGCAGGTTTGTATCTTGTTGGAACCCCAATTGGCAATC
TTGAAGATATTACTCTCAGGGCTTTGCGGGTCTTGAAATCAGCAGATGTGATTCTTTCAGAAGATACAAGGCATTCTGGAAAATTGCTGC
ACTATTATAACATTAAAACTCCTCTTTTATCACAAATTTaACGAGTCTCAAAGAGCACAAGTGGTGCTGAGGAAATTACAAGATGGTGAA
ATTGTCGCCCTGATCAGCGATGCTGGCACACCAGGCATCAGTGACCCTGGAATGGAACTGGCTAAGCTGTGTGCGGAAAAAAATATACCT
GTTGTTCCCATTCCTGGGCCTTCTGCTGTGGTAACTGCTCTTTCAGCCTCTGGCTTACCTACGAACGAGTTCTCATTTGTTGGTTTTCTT
CCAAAACATAATTCTTCXGAGGAAGGAAAGGCTGATACTTTCAGCAAAXTGAATCAGCCACACAAATCTTCTTCATTTCGCCTCACAAGC
TTTCTCAATTTCTTGAAAGAAAAGGGGGGCCCTTTTTGGGGCCCCTTTTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan