ESTScan Details for Unigene SGN-U343563

Score 
-537
Direction 
Forward
Predicted Peptide Sequence 
TIHWPSFYNVVTGKTLALPNXNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFALIFVKSAHFLTNXPKSAKSLINQ
KNRPEIGLSVVPVWNKSPLLKNVDSXVKGRKNVYQGDGPLREPSPYSVFWGRGAVSTKSXTLRXAPDXKLTGKPATWRKRREKAXDRPKR
XAVKPXAVTQTAGX
Predicted Coding Sequence 
ACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTXAATCGCCTTGCAGCACATCCCCCTTTC
GCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCAAATTGTAAGCGTT
AATATTTTGTTAAAATTCGCGTTAATTTTTGTTAAATCAGCTCATTTTTTAACCAATANGCCGAAATCGGCAAAATCCCTTATAAATCAA
AAGAATAGACCXGAGATAGGGTTGAGTGTTGTTCCAGTTTGGAACAAGAGTCCACTATTAAAGAACGTGGACTCCNACGTCAAAGGGCGA
AAAAACGTCTATCAGGGCGATGGCCCACTACGTGAACCATCACCCTATTCAGTTTTTTGGGGTCGAGGTGCCGTAAGCACTAAATCGGAX
ACCCTAAGGGNAGCCCCCGATXTAAAACTGACGGGGAAACCGGCGACGTGGCGAAAAAGGAGGGAAAAAGCGAANGACCGGCCTAAGCGC
XTGGCAGTGAAGCCANCTGCCGTAACACAAACCGCCGGCTAX
Edits in Original Sequence 
GCTAAAACTTTCCGGAGATTTGGCTGGCCGGAAAAAGGTACTACCCCTCCCTCTATTTTCCGTTTGGTTAGTTGCTCATCGTCCATGATA
TTTAGCTATTAATGTGAAAAATGGTTCATTCCGTGTTATTAACCAATATGAATGAATCTATACATCCAGTTGTTCTCTAGCTTTCGATTT
AAAATAGTTTGAAAGCTTTCAAGT
(5')ACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTT
XAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCT
GAATGGCGAATGGCAAATTGTAAGCGTTAATATTTTGTTAAAATTCGCGTTaAATTTTTGTTAAATCAGCTCATTTTTTAACCAATANGC
CGAAATCGGCAAAATCCCTTATAAATCAAAAGAATAGACCXGAGATAGGGTTGAGTGTTGTTCCAGTTTGGAACAAGAGTCCACTATTAA
AGAACGTGGACTCCNACGTCAAAGGGCGAAAAAACGTCTATCAGGGCGATGGCCCACTACGTGAACCATCACCCTATTCAGTTTTTTGGG
GTCGAGGTGCCGTAAGCACTAAATCGGAXACCCTAAGGGNAGCCCCCGATXTAAAACTGACGGGGAAACCGGCGACGTGGCGAAAAAGGA
GGGAAAAAGCGAANGACCGGCCTAAGCGCXTGGCAGTGAAcGCCANCTGCCGTAACACAAACCGCCGGCTAX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan