Notice: The SGN server will be upgraded later today. SGN may be intermittently unavailable during the upgrade. We apologize for any inconvenience.

ESTScan Details for Unigene SGN-U343564

Score 
572
Direction 
Forward
Predicted Peptide Sequence 
NFRAGXPPRWRAALELVDPRAAGIRHEGGINLSGGQKQRIQLARAVYQDCDIYLLDDVFSAVDAHTGSEIFKECVRGILKDKTILLVTAP
SGLLANIDLILVMRDGMIVQSGKYNELLEAGMDFKALVAAHETSLELVDVETNNESTASLEVSKSSRRLSRQGEENGEDNSQQSTSDRGN
SKLIKEEERETGKVSLVVYKQYVTEAFGWWGVVLVFVVFFLVARFSNGSDYWLAYETSADRAMXFNPSLXIEIYGIIALVSSXVDSGQDV
FCDTHGA
Predicted Coding Sequence 
AACTTTAGAGCTGGANCTCCACCGCGGTGGCGNGCCGCTCTAGAACTAGTGGATCCCCGGGCTGCAGGAATTCGGCACGAGGGTGGCATC
AATCTCAGTGGCGGCCAGAAACAGCGAATTCAGCTTGCAAGAGCTGTTTATCAGGACTGTGATATTTATTTACTTGATGATGTCTTCAGT
GCAGTTGATGCTCACACTGGCTCTGAGATCTTCAAGGAATGTGTGAGGGGAATTCTTAAAGATAAAACCATTTTGCTTGTCACXGCACCA
AGTGGACTTCTTGCAAATATTGACCTGATCCTCGTCATGCGAGATGGGATGATTGTGCAATCTGGCAAGTATAATGAGTTACTAGAAGCT
GGCATGGATTTTAAAGCGCTAGTAGCTGCACATGAAACCTCTTTAGAACTTGTTGATGTGGAAACCAACAATGAAAGCACCGCTTCCCTC
GAAGTATCAAAATCTTCTCGCAGATTATCTAGACAGGGGGAAGAAAATGGAGAGGATAACTCTCAACAGTCTACATCTGATAGGGGTAAC
TCAAAACTTATAAAGGAAGAAGAAAGAGAAACTGGAAAAGTTAGTCTTGTGGTGTACAAGCAATATGTTACTGAAGCTTTTGGATGGTGG
GGTGTGGTGTTAGTTTTTGTTGTTTTCTTTCTTGTGGCAAGGTTCTCTAATGGAAGTGATTATTGGCTGGCATATGAAACTTCAGCAGAT
CGTGCCATGTNCTTCAATCCTTCTTTGNTCATTGAGATATATGGTATTATTGCACTTGTTTCGTCTGXTGTTGATAGTGGCCAGGATGTA
TTTTGTGACACTCATGGGGCTTAA
Edits in Original Sequence 
(5')AACTTTAGAGCTGGANCTCCACCGCGGTGGCGNGCCGCTCTAGAACTAGTGGATcCCCCGGGCTGCAGGAATTCGGCACGAGGGTG
GCATCAATCTCAGTGGCGGCCAGAAACAGCGAATTCAGCTTGCAAGAGCTGTTTATCAGGACTGTGATATTTATTTACTTGATGATGTCT
TCAGTGCAGTTGATGCTCACACTGGCTCTGAGATCTTCAAGGAATGTGTGAGGGGAATTCTTAAAGATAAAACCATTTTGCTTGTCACXG
CACCAAGTGGACTTCTTGCAtAATATTGACCTGATCCTCGTCATGCGAGATGGGATGATTGTGCAATCTGGCAAGTATAATGAGTTACTA
GAAGCTGGCATGGATTTTAAAGCGCTAGTAGCTGCACATGAAACCTCTTTAGAACTTGTTGATGTGGAAACCAACAATGAAAGCACCGCT
TCCCTCGAAGTATCAAAATCTTCTCGCAGATTATCTAGACAGGGGGAAGAAAATGGAGAGGATAACTCTCAACAGTCTACATCTGATAGG
GGTAACTCAAAACTTATAAAGGAAGAAGAAAGAGAAACTGGAAAAGTTAGTCTTGTGGTGTACAAGCAATATGTTACTGAAGCTTTTGGA
TGGTGGGGTGTGGTGTTAGTTTTTGTTGTTTTCTTTCTTGTGGCAAGGTTCTCTAATGGcAAGTGATTATTGGCTGGCATATGAAACTTC
AGCAGATCGTGCCATGTNCTTCAATCCTTCTTTGNTCATTGAGATATATGGTATTATTGCACTTGTTTCGTCTGXTGTTGATAGTGGCCA
GGATGTATTTTGTGACACTCATGGGGCTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan