ESTScan Details for Unigene SGN-U343568

Score 
-300
Direction 
Forward
Predicted Peptide Sequence 
TIHWPSFYNVVTGKTLALPNXNRLAAHPPFASWRNSEKARTDRPSQQLRSLNGEWQIVSVNILLKFALIFVKSAHFLTNRPKSAKSLINQ
KIRPEIGLSVVPVWNKSPLLKNVDSNVKXAKNRLSGRWPLSXNITLFKFFGAEVP
Predicted Coding Sequence 
ACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTXAATCGCCTTGCAGCACATCCCCCTTTC
GCCAGCTGGCGTAATAGCGAAAAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCAAATTGTAAGCGTT
AATATTTTGTTAAAATTCGCGTTAATTTTTGTTAAATCAGCTCATTTTTTAACCAATAGGCCGAAATCGGCAAAATCCCTTATAAATCAA
AAGATTAGACCXGAGATAGGGTTGAGTGTTGTTCCAGTTTGGAACAAGAGTCCACTATTAAAGAACGTGGACTCCAACGTCAAAGXGGCG
AAAAACCGTCTATCAGGGCGATGGCCACTAAGTGAXAACATCACCCTATTCAAGTTTTTTGGGGCCGAGGTGCCGTAA
Edits in Original Sequence 
GTCAGACGACTGTCATAAAGAGGAATCCATATGCATGAAACTTCTATGGTTATGTAAATGACAGATTGACAACCAAGGTGCGTGGGTTGC
CTCCTTAAAGAAACTGTGTTTTCTCTTTTGTTATTGGTCCTCATAGTTGATCACTCTATAATTGCGTTGATCCTTGGTAATAATTCTTGT
CAAATAGTTATGGCTGTAAATTATATCTTTCCTTTGGTTCTAAATTTTGATGTAAATTAGTACATAAGTTTTTGCATGCCGGTTAATTCG
ATGAG
(5')ACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTXAATCGCCTTGCAGCACAT
CCCCCTTTCGCCAGCTGGCGTAATAGCGAAAAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCAAATT
GTAAGCGTTAATATTTTGTTAAAATTCGCGTTaAATTTTTGTTAAATCAGCTCATTTTTTAACCAATAGGCCGAAATCGGCAAAATCCCT
TATAAATCAAAAGATTAGACCXGAGATAGGGTTGAGTGTTGTTCCAGTTTGGAACAAGAGTCCACTATTAAAGAACGTGGACTCCAACGT
CAAAGXGGCGAAAAACCGTCTATCAGGGCGATGGCCACTAAGTGAXAACATCACCCTATTCAAGTTTTTTGGGGCCGAGGTGCCGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan