ESTScan Details for Unigene SGN-U343603

Score 
-123
Direction 
Forward
Predicted Peptide Sequence 
TIHWPSFYNVXDWENPGVTNLIALQHIPLSPAGVIAKRPAPIALPTVAQPEWRMAX
Predicted Coding Sequence 
ACAATTCACTGGCCGTCGTTTTACAACGTCGXTGACTGGGAAAACCCTGGCGTTACCAACTTAATCGCCTTGCAGCACATCCCCCTTTCG
CCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCAACAGTTGCGCAGCCTGAATGGCGAATGGCNNAA
Edits in Original Sequence 
GCCAAGCAAGTCTTGCAAATTGAAGAATTTGCGAGCAATTTCAAGTGATAGTCTCATTCTTCGGTCTCTTGGGCCATGTGCCGTGTTGAT
TTTGCTGTGTCTATCTTTCTTCGAAGGTCCTACACCAGCACTACCACTCGTAGTTCTCTTGTTGTTTTTTCTACGAATAGTACTAGTACT
GCTACTACTCTTCTCATCCTTCTTGTTATTATTGCAGCTTTTTATGATTGATTGATCTTCTTCTATTTTATCTAGTTTGTCCGAATCAGC
AGCTTCTTCTGCAGGAATATTGGTATTCTGATCGTAACTAGGTTGGATGAATTGAAAATCATGGAAATATTGGATGAATTCGGGTTCATA
TTGCATAGAAGGAGATGGAATATTAATGTGAAAGAAAGATGAAGAGCTGGAAATATTGGGGCTGTAATTGCTCGAAGGGTACATCTTT
(5')
ACAATTCACTGGCCGTCGTTTTACAACGTCGXTGACTGGGAAAACCCTGGCGTTACCAACTTAATCGCCTTGCAGCACATCCCCCTTT
CGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCAACAGTTGCGCAGCCTGAATGGCGAATGGCNNAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan