ESTScan Details for Unigene SGN-U343693

Score 
691
Direction 
Forward
Predicted Peptide Sequence 
LALILNSNNLSGEIQPVLDALDSLKIFDIGNNKISGEIPLTLAGCKSLEVVDLSSNNLSGSLNDAITKWSNLKFLSLARNKFSGSLPSWL
FTFQAIHTLDFSGNKFSGYIPDGNFNTSPNFYNGDIRKTISAVPSISARSLDIKLSLVADETSLSFKYNLTTTIGIDLSDNLLHGEIPEG
LFGLHGLEYLNLSYNFLNGPVPGSLGKLQKLKALDLSHNSLSGHIPENITSLRNLTVLNLSYNCFSGVISTKRGYWKFPGAFAGNPDLCM
ESSGNVCQRTLPVKPGKXXWRGNGRGTIXQFGFSV
Predicted Coding Sequence 
CTGGCGCTGATACTAAACAGTAATAATCTTTCTGGGGAAATTCAGCCAGTGCTTGACGCGTTGGATAGTCTAAAGATATTTGATATAGGA
AACAACAAGATTTCTGGTGAGATCCCACTGACATTGGCAGGCTGCAAGTCGTTGGAAGTTGTTGACTTAAGCTCTAACAATCTCTCAGGA
TCTCTAAATGATGCAATAACCAAATGGTCAAACCTCAAATTCCTCTCCCTTGCTAGGAACAAGTTCAGTGGATCTCTGCCAAGTTGGTTG
TTTACATTTCAGGCTATTCATACTCTAGATTTTTCTGGAAACAAATTCTCAGGATATATACCAGATGGTAACTTTAACACTAGTCCAAAT
TTCTACAACGGCGACATTAGGAAAACCATTTCTGCAGTACCATCAATTTCAGCTCGAAGCCTGGATATCAAACTTTCACTCGTTGCTGAT
GAAACTAGTTTGAGCTTCAAGTATAACCTCACAACCACAATTGGAATTGATCTGTCTGACAATTTGCTTCATGGTGAAATTCCAGAAGGT
CTGTTCGGATTACATGGTCTGGAGTACCTTAACTTGTCATACAATTTTCTTAATGGTCCAGTTCCAGGGAGTTTAGGGAAGTTGCAGAAG
CTAAAGGCACTTGATTTGTCACACAATTCTTTATCTGGCCACATCCCTGAAAACATTACTTCCCTCAGAAATTTGACAGTTTTAAATCTT
TCATATAATTGTTTCTCTGGTGTTATTTCGACAAAACGAGGTTATTGGAAATTTCCTGGAGCATTTGCTGGCAATCCAGACTTGTGTATG
GAATCATCTGGTAATGTCTGTCAAAGAACTTTGCCTGTAAAGCCAGGGAAGAANNATTGGAGAGGAAATGGAAGAGGGACCATTXATCAG
TTTGGATTTTCTGTATAA
Edits in Original Sequence 
GGATTCCTTTGAACATTGTAGGATGTTTCCAACTACTGGCGCTGATACTAAACAGTAATAATCTTTCTGGGGAAATTCAGCCAGTGCTTG
ACGCGTTGGA
(5')CTGGCGCTGATACTAAACAGTAATAATCTTTCTGGGGAAATTCAGCCAGTGCTTGACGCGTTGGATAGTCTAAAGA
TATTTGATATAGGAAACAACAAGATTTCTGGTGAGATCCCACTGACATTGGCAGGCTGCAAGTCGTTGGAAGTTGTTGACTTAAGCTCTA
ACAATCTCTCAGGATCTCTAAATGATGCAATAACCAAATGGTCAAACCTCAAATTCCTCTCCCTTGCTAGGAACAAGTTCAGTGGATCTC
TGCCAAGTTGGTTGTTTACATTTCAGGCTATTCATACTCTAGATTTTTCTGGAAACAAATTCTCAGGATATATACCAGATGGTAACTTTA
ACACTAGTCCAAATTTCTACAACGGCGACATTAGGAAAACCATTTCTGCAGTACCATCAATTTCAGCTCGAAGCCTGGATATCAAACTTT
CACTCGTTGCTGATGAAACTAGTTTGAGCTTCAAGTATAACCTCACAACCACAATTGGAATTGATCTGTCTGACAATTTGCTTCATGGTG
AAATTCCAGAAGGTCTGTTCGGATTACATGGTCTGGAGTACCTTAACTTGTCATACAATTTTCTTAATGGTCCAGTTCCAGGGAGTTTAG
GGAAGTTGCAGAAGCTAAAGGCACTTGATTTGTCACACAATTCTTTATCTGGCCACATCCCTGAAAACATTACTTCCCTCAGAAATTTGA
CAGTTTTAAATCTTTCATATAATTGTTTCTCTGGTGTTATTTCGACAAAACGAGGTTATTGGAAATTTCCTGGAGCATTTGCTGGCAATC
CAGACTTGTGTATGGAATCATCTGGTAATGTCTGTCAAAGAACTTTGCCTGTAAAGCCAGGGAAGAANNATTGGAGAGGAAATGGAAGAG
GGACCATTXATCAGTTTGGATTTTCTGTATAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan