ESTScan Details for Unigene SGN-U343722

Score 
73
Direction 
Reverse
Predicted Peptide Sequence 
MPGQAAEDSSSEGXEVDHNIELESGDKPPSDAPYRMAPPELEELRNTLREILEAGHIRPSNTPYGAPVLFLKKKDGRCTYALTSRRLNKV
KNKNKYAILLIADLFDDLGXDKYFTKIDLGKGYYKVRIAEGDEPKXNVNDRYRAYGWLVMPFSFTNAPATFCTLMNNILHPYLDQFVVVY
LDDKSSIATPWRNTWSTEESLPNLMKELALHQKAEWEFDQPKVHFLAMLSGKENSGWPAARGIH
Predicted Coding Sequence 
ATGCCCGGACAGGCTGCCGAAGACTCTAGCTCGGAGGGCGXTGAGGTAGATCATAATATAGAGCTGGAGTCGGGAGACAAGCCACCCTCT
GATGCACCTTACCGCATGGCTCCACCCGAGTTAGAAGAGCTAAGGAACACGTTGAGGGAGATCCTCGAGGCCGGTCACATCCGTCCATCC
AACACACCTTATGGAGCGCCTGTGCTATTCTTGAAAAAGAAAGATGGTCGTTGCACTTATGCATTGACTAGCAGGCGXCTCAATAAGGTA
AAAAATAAGAACAAATATGCTATCCTGCTAATTGCAGATTTATTTGATGACTTGGGTAGXGACAAGTACTTCACCAAGATAGATCTCGGG
AAAGGCTACTACAAAGTGCGCATCGCAGAGGGAGATGAGCCAAAGAXCAACGTGAATGACAGATACAGAGCATATGGGTGGTTGGTGATG
CCTTTCAGCTTTACCAATGCACCCGCCACCTTTTGCACGCTGATGAATAATATCCTTCATCCCTACTTGGACCAGTTCGTGGTGGTGTAC
TTGGATGACAAGTCATCTATAGCAACACCTTGGAGGAACACGTGGAGCACTGAGGAAAGTCTTCCAAATCTTATGAAAGAACTAGCTCTA
CATCAAAAGGCAGAATGGGAGTTTGACCAACCCAAGGTGCACTTTTTGGCCATGTTATCAGGAAAGGAGAACTCCGGATGGCCTGCAGCC
CGGGGGATCCACTAG
Edits in Original Sequence 
AGGTAGATCATAATATAGAGCTGGAGTCGGGAGACAAGCCACCCTCTGATGCACCTTACCGCATGGCTCCACCCGAGTTAGAAGAGCTAA
GGAACACGTTGAGGGAGATCCTCGAGGCCGGTCACATCCGTCCATCCAACACACCTTATGGAGCGCCTGTGCTATTCTTGAAAAAGAAAG
(5')ATGCCCGGACAGGCTGCCGAAGACTCTAGCTCGGAGGGCGXTGAGGTAGATCATAATATAGAGCTGGAGTCGGGAGACAAGCCACC
CTCTGATGCACCTTACCGCATGGCTCCACCCGAGTTAGAAGAGCTAAGGAACACGTTGAGGGAGATCCTCGAGGCCGGTCACATCCGTCC
ATCCAACACACCTTATGGAGCGCCTGTGCTATTCTTGAAAAAGAAAGATgGGTCGTTGCACTTATGCATTGACTAGCAGGCGXCTCAATA
AGGTAAAAAATAAGAACAAATATGCTATCCTGCTAATTGCAGATTTATTTGATaGACTTGGGTAGXGACAAGTACTTCACCAAGATAGAT
CTCGGGAAAGGCTACTACAAAGTGCGCATCGCAGAGGGAGATGAGCCAAAGAXCAACGTGAATGACtAGATACAGAGCATATGGGTGGTT
GGTGATGCCTTTCAGCTTTACCAATGCACCCGCCACCTTTTGCACGCTGATGAATAATATCCTTCATCCCTACTTGGACCAGTTCGTGGT
GGTGTACTTGGATGACAtAGTCATCTATAGCAACACCTTGGAGGAACACGTGGAGCACTGAGGAAAGTCTTCCAAATCTTATGAAAGAAC
TAGCTCTACATCAAAAGGCAGAAgTGGGAGTTTGACCAACCCAAGGTGCACTTTTTaGGCCATGTTATCAGGAAAGGAGAACTCCGGATG
GCCTGCAGCCCGGGGGATCCACTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan