ESTScan Details for Unigene SGN-U343776

Score 
109
Direction 
Forward
Predicted Peptide Sequence 
KLELPXGGGRXTTSGSPGLHVFGTRILENAYLFMVEMEKLGISPDVFTYTILISAFYKVNRWHIADGLWNLMVRKGCMPNVATFNVKIQF
MVNMTFAWEANKLLQLMKRIGITPHEVTYNLVIKGFFLLENLPMAKRIYSAFHGAGLQAKFYNLSNHDSLPVYACDFDLSYSMCKESMEN
NWFPSSDIIKNILEGLCKDGTDEKMRNARFLFILAKKKILSFSTETLDAMLXILDRSLKYEHV
Predicted Coding Sequence 
AAGCTGGAGCTCCCCGXCGGTGGCGGCCGCNCTACAACTAGTGGATCCCCCGGGCTGCATGTATTCGGCACGAGGATCTTGGAGAACGCG
TATTTGTTCATGGTTGAGATGGAAAAGTTAGGTATATCACCTGATGTTTTTACTTATACGATACTTATATCTGCCTTCTATAAAGTTAAC
CGATGGCACATTGCTGATGGATTGTGGAACCTCATGGTCCGTAAAGGTTGTATGCCTAATGTTGCTACCTTTAATGTTAAAATTCAATTC
ATGGTAAATATGACGTTTGCTTGGGAAGCTAATAAATTGTTGCAGTTGATGAAACGTATTGGGATTACTCCACATGAGGTTACATACAAT
TTAGTGATCAAAGGCTTTTTCCTACTAGAGAATCTTCCTATGGCTAAAAGAATCTACTCTGCTTTCCATGGTGCXGGGCTTCAAGCCAAA
TTCTACAATCTATCAAACCATGATTCATTACCTGTGTATGCATGTGATTTTGATTTGTCATATTCTATGTGTAAAGAAAGCATGGAAAAT
AATTGGTTCCCAAGTTCGGATATAATTAAAAATATCCTTGAAGGGCTGTGCAAGGATGGAACAGACGAAAAGATGCGAAACGCTCGATTT
TTATTCATCCTGGCTAAGAAAAAGATACTCTCTTTCTCAACAGAAACTTTGGACGCGATGCTGNCAATACTAGATCGTAGCTTAAAGTAC
GAACACGTGTAA
Edits in Original Sequence 
(5')AAGCTGGAGCTCCCCGXCGGTGGCGGCCGCNCTACAACTAGTGGATCCCCCGGGCTGCATGTATTCGGCACGAGGATCTTGGAGAA
CGCGTATTTGTTCATGGTTGAGATGGAAAAGTTAGGTATATCACCTGATGTTTTTACTTATACGATACTTATATCTGCCTTCTATAAAGT
TAACCGATGGCACATTGCTGATGGATTGTGGAACCTCATGGTCCGTAAAGGTTGTATGCCTAATGTTGCTACCTTTAATGTTAAAATTCA
ATTCATGGTAAATATGACGTTTGCTTGGGAAGCTAATAAATTGTTGCAGTTGATGAAACGTATTGGGATTACTCCACATGAGGTTACATA
CAATTTAGTGATCAAAGGCTTTTTCCTACTAGAGAATCTTCCTATGGCTAAAAGAATCTACTCTGCTTTCCATGGTGCXGGGCTTCAAGC
CAAATTCTACAATCTATCAAACCATGATTCATTACCTGTGTATaGCATGTGATTTTGATTTGTCATATTCTATGTGTAAAGAAAGCATGG
AAAATAATTGGTTCCCAAGTTCGGATATAATTAAAAATATCCTTGAAGGGCTGTGCAAGGATGGAACAGACGAAAAGATGCGAAACGCTC
GATTTTTATTCATCCTGGCTAAGAAAAAGATACTCTCTTTCTCAACAGAAACTTTGGACGCGATGCTGNCAATACTAGATCGTAGCTTAA
AGTACGAACACGTGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan