ESTScan Details for Unigene SGN-U343805

Score 
-121
Direction 
Forward
Predicted Peptide Sequence 
TIHWPSFYNVVTGKTLALPNXNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSV
Predicted Coding Sequence 
ACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTXAATCGCCTTGCAGCACATCCCCCTTTC
GCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCAAATTGTAAGCGTT
TAA
Edits in Original Sequence 
GGAGTTTTTTTCCCTTTCAATGTAAGTTCTTGTTCAATTGATGCTTATCTATCATCTACTTGAGATGCTTTTTGAAAATCACCAATTTTT
GCTGGAGTATAGGACTTCAGCCAGAGGCAACAATGGTACTTCACAGTACTGAAAGTGTTGACTGATTATGATATTTTCATTGATCCCAGA
AAAGGAAGCATGATGGAGAGGAGGAATTTAATGATGTTCACAAACACAAGAGAAGCAAGCACAAGAGCTCAAAGATTGATGATATTGGTG
CAATAAAGGTAGCAAGCTGAAATATGTGTGTGGTTATATCATTTGTTTTATCCTCAGACTTTGCAATTGAGAATTTGGAGGGATCCTTTA
CTTAGTATTGTGGAAAATCAGAGGTACAGAAGTTAATTCATGCTATATCCCATTAATTGAATGCTATATCCCATTAATTGAAG
(5')ACA
ATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTXAATCGCCTTGCAGCACATCCCCCTTTCGCC
AGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCCTGAATGGCGAATGGCAAATTGTAAGCGTTTAA
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan