ESTScan Details for Unigene SGN-U343806

Score 
395
Direction 
Forward
Predicted Peptide Sequence 
GAHRGGGRSRTSGSPXAAGKFLRACELKAHTDWIRSLDLSLPVYVNGESSLLLVSSSQDKGIRIWKMTLQDSSASNKKQQTSLASYIKGP
VLVAGSSSYQISMESLLIGHEDWVYSVEWQPPSTSSVEGIECFQPQSILSASMDKTMLIWQPEKTTGIWMNVVTVGELSHCALGFYGGHW
SPNADFILAHGYGGSFHLWKKCGIEYDDWKPQKXPSGHFAAVSDIAWAXMWGYMMSVSHDQTTRVFAPWLXHTAYRMRNPXHEXARPSXH
GHDIXCVPVIKGKEIIVLLAVQ
Predicted Coding Sequence 
XCTGGAGCTCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGXGGCTGCAGGAAAATTTCTTCGTGCTTGTGAGTTAAAGGCT
CATACAGACTGGATTAGGAGTTTAGATCTCTCATTGCCTGTGTATGTGAATGGTGAATCTAGTCTTCTACTTGTAAGTTCATCCCAAGAC
AAAGGCATTCGCATATGGAAGATGACCTTACAGGATTCTTCAGCTAGTAACAAGAAGCAGCAAACAAGTTTGGCTTCTTACATTAAAGGT
CCTGTTCTTGTAGCTGGCTCATCCTCTTATCAGATCTCTATGGAATCTCTCCTCATTGGGCATGAAGATTGGGTATACTCAGTGGAATGG
CAGCCGCCATCGACTTCTTCTGTTGAGGGAATTGAGTGTTTTCAGCCTCAAAGCATTTTATCTGCATCCATGGATAAGACAATGTTGATC
TGGCAACCTGAAAAGACAACTGGTATTTGGATGAATGTAGTCACCGTTGGGGAATTAAGTCACTGTGCTTTGGGATTTTATGGTGGTCAC
TGGAGTCCAAATGCAGATTTTATTTTAGCTCATGGATATGGTGGATCTTTTCACCTCTGGAAAAAATGTGGTATTGAGTATGATGACTGG
AAGCCACAAAAAGXTCCATCTGGACACTTTGCTGCAGTGTCAGACATCGCCTGGGCTAXGATGTGGGGATATATGATGTCTGTCAGTCAT
GATCAGACAACTAGAGTATTTGCTCCCTGGCTCNNACATACAGCGTACAGAATGAGGAATCCTGNNCATGAAXTTGCTCGCCCCTCAGNT
CATGGTCATGACATAANTTGTGTCCCAGTAATCAAAGGAAAGGAAATCATCGTTTTGTTGGCGGTGCAA
Edits in Original Sequence 
(5')XCTGGAGCTCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGXGGCTGCAGGAAAATTTCTTCGTGCTTGTGAGTTAAA
GGCTCATACAGACTGGATTAGGAGTTTAGATCTCTCATTGCCTGTGTATGTGAATGGTGAATCTAGTCTTCTACTTGTAAGTTCATCCCA
AGACAAAGGCATTCGCATATGGAAGATGACCTTACAGGATTCTTCAGCTAGTAACAAGAAGCAGCAAACAAGTTTGGCTTCTTACATTAA
AGGTCCTGTTCTTGTAGCTGGCTCATCCTCTTATCAGATCTCTATGGAATCTCTCCTCATTGGGCATGAAGATTGGGTATACTCAGTGGA
ATGGCAGCCGCCATCGACTTCTTCTGTTGAGGGAATTGAGTGTTTTCAGCCTCAAAGCATTTTATCTGCATCCATGGATAAGACAATGTT
GATCTGGCAACCTGAAAAGACAACTGGTATTTGGATGAATGTAGTCACCGTTGGGGAATTAAGTCACTGTGCTTTGGGATTTTATGGTGG
TCACTGGAGTCCAAATGCAGATTTTATTTTAGCTCATGGATATGGTGGATCTTTTCACCTCTGGAAAAAATGTGGTATTGAGTATGATGA
CTGGAAGCCACAAAAAGXTCCATCTGGACACTTTGCTGCAGTGTCAGACATCGCCTGGGCTAXGATGTGGGGATATATGATGTCTGTCAG
TCATGATCAGACAACTAGAGTATTTGCTCCCTGGCTCNNACATACAGCGTACAGAATGAGGAATCCTGNNCATGAAXTTGCTCGCCCCTC
AGNTCATGGTCATGACATAANTTGTGTCCCAGTAATCAAAGGAAAGGAAATCATCGTTTTGTTGGCGGTGCAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan