ESTScan Details for Unigene SGN-U343880

Score 
-26
Direction 
Forward
Predicted Peptide Sequence 
MRVKESNDSGDYAHXXQAKIKXNLEGGPXYPIRPIVSRITIHWPSFYNVVTGKTLAFPNXNRLAAHPPFGSWRNNEKAPARSPFQTLRHP
DGEWPIVGVKFWLKSG
Predicted Coding Sequence 
ATGAGAGTCAAGGAAAGTAATGATTCTGGTGACTATGCTCATGNNANACAAGCAAAAATAAAAAANAACCTCGAGGGGGGGCCCGXGTAC
CCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTTCCCAACTTX
AATCGCCTTGCAGCACATCCCCCTTTCGGCAGCTGGCGTAATAACGAAAAGGCCCCCGCCCGATCGCCCTTCCAAACATTGCGCCACCCT
GATGGCGAATGGCCAATTGTAGGCGTTAAATTTTGGTTAAAATCGGGTTAA
Edits in Original Sequence 
GCAGTCAAAAATTCTAACAAGTTCAAGCTCCAGGCTCCTGCTTACAACTGTTATCTAATTTTTGGTAATATCCTTCTCCAAGATAAAGAT
GTTCTAGTACTTCATTATTTGATCAATTTGACATGACTTTCAAATGTTGAAACAAACTCGTAGGTAAGTTTTCCGAGAAGACATGTAAGA
TAGATTTAAGATTCGAAAGTGGGGGGGCATGTTGTCAATTTTTTGAAGTTCTAATGGATCCATGCAGTTGATTTGATTGCAAGTTTAAAA
CTTGCAAAATTCCAACCACATGAGGAATGTGTCATTGAGGTGATTATCTCCTAAAATCAAGAACTTGTAACTCTTTGCAATTGTCTTTAA
TTTTGAGGATTGTTTCCTTTCATTACAGAAGCTTAATTAGTATGAAGTTGGTTCATGTTTTTAACTATTCTTGTATGGATATCCTTGCAA
ATATGAGAGTCAAGGAAAGTAATGATTCTGAGTGACTATGCTC
(5')ATGAGAGTCAAGGAAAGTAATGATTCTGaGTGACTATGCTCAT
GNNANACAAGCAAAAATAAAAAANAACCTCGAGGGGGGGCCCGXGTACCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCG
TCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTTCCCAACTTXAATCGCCTTGCAGCACATCCCCCTTTCGGCAGCTGGCGTAAT
AACGAAAAGGCCCCCGCCCGATCGCCCTTCCAAACATTGCGCCACCCTGATGGCGAATGGCCAATTGTAGGCGTTAAATTTTGGTTAAAA
TCGGGTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan