ESTScan Details for Unigene SGN-U343952

Score 
293
Direction 
Forward
Predicted Peptide Sequence 
MASPSSPAPFSSSAAHFQAPHQSISVSGKSSISSIASSTIHSRASHMLPYQSLTVHSFSTSELAVEHKVSDQIAVLTGIFSKPNRSNEEI
KIDLESNNVTVTHDLVIRALRSFNTAPDAARKFFNWVKENESERLSSKVYNYMLGILGSNGFVKEFWSMVEIMKSKRYGVSKGTFNRAIE
RFEKEKLYRDLEKPKKLDGSELAGNSSEEVWSRVCNWIRGKVWGRDXGKPTAKSKIRFLSGIDQFN
Predicted Coding Sequence 
ATGGCTTCTCCTTCTTCTCCGGCACCATTCTCTAGCTCAGCCGCACATTTCCAGGCACCTCATCAATCAATCTCCGTTTCAGGTAAATCA
TCTATTAGTTCTATCGCTTCTTCAACTATCCACTCACGTGCATCTCACATGCTCCCTTACCAATCACTCACTGTTCATAGTTTCTCCACA
TCTGAATTGGCGGTCGAACACAAAGTTTCAGATCAAATCGCTGTTTTAACTGGTATTTTCTCTAAACCAAACCGGAGTAATGAAGAAATT
AAGATTGATTTAGAGTCTAATAATGTTACTGTCACGCATGATTTGGTTATAAGGGCGTTAAGGAGCTTTAATACCGCCCCTGATGCGGCA
CGTAAGTTTTTTAACTGGGTTAAGGAGAATGAGAGCGAGAGGTTGAGTTCAAAGGTGTATAATTATATGTTAGGGATATTGGGGTCTAAT
GGGTTTGTCAAGGAGTTTTGGAGTATGGTTGAAATCATGAAAAGTAAAAGGTATGGAGTGTCCAAGGGCACGTTTAATCGAGCTATTGAG
AGATTTGAAAAGGAGAAACTGTACCGGGACCTGGAAAAGCCTAAAAAGTTGGATGGTTCTGAGCTGGCTGGCAATTCAAGCGAAGAAGTT
TGGTCTAGGGTTTGCAATTGGATTCGGGGAAAGGTTTGGGGAAGAGATGXTGGAAAACCAACTGCAAAATCGAAAATCCGGTTTTTGAGT
GGAATTGATCAGTTTAAT
Edits in Original Sequence 
GTTTTTTTTGATTAATTAAGCAATCGGAATCTACCAAGAAGAATGCGTAATCAACAGCAATGGCTTCTCCTTCTTCTCCGGCACCATTCT
CTAGCTCAGCCGCACATTTCCAGGCACCTCATCAATCAATCTCCGTTTCAGGTAAATCGATCTATTAGTTCTATCGCTTCTTCAACTA
(5')
ATGGCTTCTCCTTCTTCTCCGGCACCATTCTCTAGCTCAGCCGCACATTTCCAGGCACCTCATCAATCAATCTCCGTTTCAGGTAAAT
CgATCTATTAGTTCTATCGCTTCTTCAACTATCCACTCACGTGCATCTCACATGCTCCCTTACCAATCACTCACTGTTCATAGTTTCTCC
ACATCTGAATTGGCGGTCGAACACAAAGTTTCAGATCAAATCGCTGTTTTAACTGGTATTTTCTCTAAACCAAACCGGAGTAATGAAGAA
ATTAAGATTGATTTAGAGTCTAATAATGTTACTGTCACGCATGATTTGGTTATAAGGGCGTTAAGGAGCTTTAATACCGCCCCTGATGCG
GCACGTAAGTTTTTTAACTGGGTTAAGGAGAATGAGAGCGAGAGGTTGAGTTCAAAGGTGTATAATTATATGTTAGGGATATTGGGGTCT
AATGGGTTTGTCAAGGAGTTTTGGAGTATGGTTGAAATCATGAAAAGTAAAAGGTATGGAGTGTCCAAGGGCACGTTTAATCGAGCTATT
GAGAGATTTGAAAAGGAGAAACTGTACCGGGACCTGGAAAAGCCTAAAAAGTTGGATGGTTCTGAGCTGGCTGGCAATTCAAGCGAAGAA
GTTTGGTCTAGGGTTTGCAATTGGATTCGGGGAAAGGTTTGGGGAAGAGATGXTGGAAAACCAACTGCAAAATCGAAAATCCGGTTTTTG
AGTGGAATTGATCAGTTTAAT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan