ESTScan Details for Unigene SGN-U343988

Score 
331
Direction 
Forward
Predicted Peptide Sequence 
MTDXSLFRSTNRYSVRETIRFMQRASNRRALMMHEPSEQIDDRQSNWAYSKPVVIIDLLWNFMYIIAAVVVLVLSINEKLEMPLRVWIIG
YCFLCMIHVVSVYLEFQRRGYGQSLFTGDGVLRPTVDSSYITLADLTPDRTRYIYILKEFGIAT
Predicted Coding Sequence 
ATGACGGATXTGTCTCTTTTTCGATCGACGAATCGTTACAGTGTTCGTGAAACGATTAGATTTATGCAAAGAGCTAGCAATCGAAGGGCA
TTGATGATGCATGAACCGTCCGAGCAAATTGATGATCGACAGAGTAATTGGGCATATTCAAAACCTGTTGTGATTATTGATCTATTGTGG
AATTTCATGTATATTATTGCTGCTGTTGTGGTTTTGGTGTTGAGTATAAATGAAAAATTGGAAATGCCTTTAAGGGTTTGGATTATTGGG
TATTGTTTTCTTTGTATGATTCATGTTGTTAGTGTTTATTTGGAGTTTCAGAGAAGAGGTTATGGGCAATCGTTGTTTACTGGAGATGGG
GTTTTGAGACCTACTGTAGATTCGAGTTATATTACTTTGGCTGATTTAACCCCGGATAGAACAAGGTATATTTATATTCTCAAAGAATTT
GGAATTGCTACTTAA
Edits in Original Sequence 
GCATCTATTTTGCTTCTTCTTAACAATTATACAAAAATAAATAAATAAATTATTATTATTGATTCAACAATATTTCTCTCAAATCATATG
AAAAAATATGTTTTTACCAAGTCCATCGAGTTCACCATTATTAAGATCAAGCAATGACGGATTGTCTCTTTTTCGATCGACGAATCGTTA
CAGTGTTCGTGAAACGATTAGATTTA
(5')ATGACGGATXTGTCTCTTTTTCGATCGACGAATCGTTACAGTGTTCGTGAAACGATTAGA
TTTATGCAAAGAGCTAGCAATCGAAGGGCATTGATGATGCATGAACCGTCCGAGCAAATTGATGATCGACAGAGTAATTGGGCATATTCA
AAACCTGTTGTGATTATTGATCTATTGTGGAATTTCATGTATATTATTGCTGCTGTTGTGGTTTTGGTGTTGAGTATAAATGAAAAATTG
GAAATGCCTTTAAGGGTTTGGATTATTGGGTATTGTTTTCTTTGTATGATTCATGTTGTTAGTGTTTATTTGGAGTTTCAGAGAAGAGGT
TATGGGCAATCGTTGTTTACTGGAGATGGGGTTTTGAGACCTACTGTAGATTCGAGTTATATTACTTTGGCTGATTTAACCCCGGATAGA
ACAAGGTATATTTATATTCTCAAAGAATTTGGAATTGCTACTTAA(3')TAAACAAAGTAGTTTATTCGTTTTCTTATAGAAATAGAACT
TGCTGAAGCTTTGTTACCCTCTTTGATGAGGGTTCCAAATGAACTTTAAATTTAGGATGTGCCC

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan