ESTScan Details for Unigene SGN-U343990

Score 
76
Direction 
Forward
Predicted Peptide Sequence 
GGGLXNRXPAKNGHHSGGVRSRTSGSPGLQEFGTRLDSXHSVSEATQIELFQVVSIFRSGISFXPVNIPFQVLGVVLLYKLTTLGLDYVF
DKQCPLCSSACVFSIPIELPKFFSVKYAVKLLKKLADDGNFKLGKVVHALLIVSNHASENHVIQNNCLINLYSRCGQLSIARHIFNRLRQ
RNIVSWSTLMTGYLHNGFTWEVPKLLKDMVSVDNLFPNEYVLSTVLSSCSNGGLLHERRQRHAFPLKNXGLRFNPNATKALLFLGYKVFK
FWKGVSGTLKILFLDSNNNYWIIVGPKRLFWNQRFFQIETLGLFFLKDCX
Predicted Coding Sequence 
XXNGGGGGCGGNCTNTGNAACCGTANACCCGCCAAAAACGGACACCACTCTGGTGGCGTCCGCTCTAGAACTAGTGGATCCCCCGGGCTG
CAGGAATTCGGCACGAGGTTGGATAGCGXTCACTCAGTAAGTGAAGCAACACAGATTGAACTGTTTCAAGTGGTATCAATTTTCAGATCT
GGCATTTCTTTTGXTCCAGTCAACATACCCTTTCAAGTGCTTGGAGTTGTATTACTCTACAAACTAACTACACTGGGACTTGACTATGTT
TTTGACAAGCAATGTCCACTGTGCTCCTCTGCATGTGTCTTCTCTATCCCAATTGAACTCCCAAAGTTCTTTTCTGTGAAGTACGCTGTA
AAGTTGTTGAAAAAGTTAGCTGATGACGGGAACTTCAAATTGGGAAAAGTTGTCCATGCGCTTCTTATTGTATCTAATCATGCCTCAGAA
AACCACGTAATTCAGAATAATTGTCTCATTAATCTCTACTCAAGGTGTGGACAACTTTCTATTGCTCGGCACATATTCAACAGATTGCGG
CAACGAAATATAGTTTCTTGGAGCACTTTAATGACAGGATATTTGCACAATGGGTTTACTTGGGAAGTACCCAAATTGTTGAAAGACATG
GTTTCAGTGGATAATTTATTTCCAAATGAGTATGTCTTGTCTACTGTACTTTCTTCTTGTTCTAATGGTGGTTTGCTACACGAAAGGCGG
CAGCGTCATGCCTTCCCTTTGAAAAATAXAGGATTAAGGTTTAATCCCAATGCCACGAAAGCCCTTCTATTCCTGGGCTACAAGGTTTTT
AAATTTTGGAAAGGGGTTTCTGGAACCCTTAAAATCTTGTTCCTGGATTCAAACAACAATTACTGGATAATTGTTGGACCTAAAAGGCTT
TTTTGGAATCAACGGTTTTTCCAAATTGAAACACTTGGGTTGTTTTTTCTAAAGGATTGTTTX
Edits in Original Sequence 
(5')XXNGGGGGCGGNCTNTGNAACCGTANACCCGCCAAAAACGGACACCACTCTGGTGGCGTCCGCTCTAGAACTAGTGGATCCCCCGG
GCTGCAGGAATTCGGCACGAGGTTGGATAGCGXTCACTCAGTAAGTGAAGCAACACAGATTGAACTGTTTCAAGTGGTATCAATTTTCAG
ATCTGGCATTTCTTTTGXTCCAGTCAACATACCCTTTCAAGTGCTTGGAGTTGTATTACTCTACAAACTAACTACACTGGGACTTGACTA
TGTTTTTGACAAGCAATGTCCACTGTGCTCCTCTGCATGTGTCTTCTCTATCCCAATTGAACTCCCAAAGTgTCTTTTCTGTGAAGTACG
CTGTAAAGTTGTTGAAAAAGTTAGCTGATGACGGGAACTTCAAATTGGGAAAAGTTGTCCATGCGCTTCTTATTGTATCTAATCATGCCT
CAGAAAACCACGTAATTCAGAATAATTGTCTCATTAATCTCTACTCAAGGTGTGGACAACTTTCTATTGCTCGGCACATATTCAACAGAT
TGCGGCAACGAAATATAGTTTCTTGGAGCACTTTAATGACAGGATATTTGCACAATGGGTTTACTTGGGAAGTACCCAAATTGTTGAAAG
ACATGGTTTCAGTGGATAATTTATTTCCAAATGAGTATGTCTTGTCTACTGTACTTTCTTCTTGTTCTAATGGTGGTTTGCTACACGAAA
GGCGGCAGCGTCATGCCTTCCCTTTGAAAAATAXAGGATTAAGGTTTAATCCCAATGCCACGAAAGCCCTTCTATTCCTGGGCTACAAGG
TTTTTAAATTTTGGAAAGGGGTTTCTGGAACCCTTAAAATCTTGTTCCTGGATTCAAACAACAATTACTGGATAATTGTTGGACCTAAAA
GGCTTTTTTGGAATCAACGGTTTTTCCAAATTGAAACACTTGGGTTGTTTTTTCTAAAGGATTGTTTX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan