ESTScan Details for Unigene SGN-U344007

Score 
624
Direction 
Forward
Predicted Peptide Sequence 
APLSAPLILADKRGRRRVNKLLTISPTATAXLSAKMAGKLGKKVGSKLGKPPTKKKQKKEPLPPKPLEKEDLFSDSEGTDGDFEEDGGSG
DEEQQEMNSDSDMSSDLDDPFAADILASGDADDCSDVHSDSDVDSDSDANDTDLVGKSKAIDDERKREEEEGDLELQLNIKEEADEFRLP
TTEELEKETNRPPDLSNLQRRIKEIVRVLSNFKVIEEEIVTRKDYVDQLKRDLGSYYGYNDFLFGSVSGAVSPVELIELIDYFESPGPIF
SGDKHFKESRRDLAGVLPXQKVSILNPLNKGSKGGASCXIIPRFPLGPPPEKMAGAPLAPKGRFHFRPEGALAPPKKESFVEYGVASGRK
KSLLAAAGEKMWYFFRNEKRGPGLNLSVHTYMEGGNNTTLRTLSERRSLDGSYTSPNNFAEIPAARGGFSGEIVITQHVEYNNLTPTENT
LHYDSIPTQGDI
Predicted Coding Sequence 
GCCCCCCTCTCTGCCCCTCTGATTCTCGCAGACAAGAGAGGAAGAAGAAGAGTTAATAAGCTTCTCACCATCTCTCCAACCGCAACTGCT
XCTCTCTCCGCTAAAATGGCTGGTAAACTCGGTAAGAAAGTGGGTTCTAAATTAGGGAAACCACCAACCAAGAAGAAGCAGAAGAAGGAA
CCTTTGCCACCTAAGCCACTGGAAAAGGAGGATCTTTTTAGTGACAGTGAAGGAACTGATGGAGATTTTGAAGAAGATGGAGGTTCTGGT
GATGAAGAACAACAGGAAATGAACTCGGATTCTGACATGTCTTCTGACTTGGATGACCCCTTTGCTGCTGATATATTAGCAAGCGGTGAT
GCTGACGATTGTTCCGATGTTCATTCCGATTCGGATGTAGATTCTGATTCAGATGCAAATGATACTGATCTTGTAGGGAAGTCAAAAGCT
ATTGATGATGAAAGGAAAAGAGAGGAGGAGGAGGGTGATTTAGAATTGCAGCTCAATATTAAAGAAGAAGCTGATGAGTTCAGATTGCCA
ACAACGGAGGAGCTCGAAAAAGAAACAAATAGACCCCCGGATCTCTCTAATCTCCAAAGGAGGATAAAAGAAATTGTTCGGGTGCTCTCA
AATTTCAAAGTCATTGAGGAAGAAATTGTGACACGTAAGGATTACGTTGATCAACTTAAAAGGGACTTGGGTTCATATTATGGATACAAT
GATTTTCTCTTTGGATCXGTAAGTGGAGCTGTTTCCCCTGTTGAGTTGATTGAACTTATTGACTATTTTGAAAGCCCCGGCCCAATTTTC
TCTGGGGACAAACACTTTAAAGAATCCAGACGGGATTTAGCAGGTGTTCTTCCTAAXCAAAAGGTGTCAATTTTGAATCCACTAAACAAA
GGGTCAAAGGGTGGGGCTAGTTGTXATATAATTCCTAGGTTCCCGTTGGGGCCACCTCCGGAGAAAATGGCGGGTGCACCACTTGCTCCA
AAGGGGAGATTCCATTTCCGGCCGGAAGGGGCCCTTGCCCCTCCAAAAAAAGAAAGTTTTGTTGAATATGGGGTCGCCTCCGGGAGGAAA
AAATCTTTGTTGGCTGCXGCGGGGGAAAAAATGTGGTATTTTTTTCGCAATGAGAAGAGAGGGCCGGGACTTAATCTCTCCGTGCATACC
TATATGGAGGGGGGTAACAACACCACTCTTCGTACACTGAGTGAAAGAAGATCCTTAGATGGGTCGTACACATCGCCGAATAATTTCGCG
GAGATCCCCGCAGCGCGCGGTGGGTTCTCAGGAGAGATTGTGATAACTCAACACGTGGAATATAACAATCTCACGCCTACXGAGAATACA
CTGCACTATGATAGCATACCAACACAGGGCGATATA
Edits in Original Sequence 
ATTGATCTCTCTCTTTACGCCTTTTTTTCTCTCTTCACTCAGCGCCCCCCTCTCTGCCCCTCTGATTCTCGCAGACAAGAGAGGAAGAAG
AAGAGTTAATA
(5')GCCCCCCTCTCTGCCCCTCTGATTCTCGCAGACAAGAGAGGAAGAAGAAGAGTTAATAAGCTTCTCACCATCTCT
CCAACCGCAACTGCTXCTCTCTCCGCTAAAATGGCTGGTAAACTCGGTAAGAAAGTGGGTTCTAAATTAGGGAAACCACCAACCAAGAAG
AAGCAGAAGAAGGAACCTTTGCCACCTAAGCCACTGGAAAAGGAGGATCTTTTTAGTGACAGTGAAGGAACTGATGGAGATTTTGAAGAA
GATGGAGGTTCTGGTGATGAAGAACAACAGGAAATGAACTCGGATTCTGACATGTCTTCTGACTTGGATGACCCCTTTGCTGCTGATATA
TTAGCAAGCGGTGATGCTGACGATTGTTCCGATGTTCATTCCGATTCGGATGTAGATTCTGATTCAGATGCAAATGATACTGATCTTGTA
GGGAAGTCAAAAGCTATTGATGATGAAAGGAAAAGAGAGGAGGAGGAGGGTGATTTAGAATTGCAGCTCAATATTAAAGAAGAAGCTGAT
GAGTTCAGATTGCCAACAACGGAGGAGCTCGAAAAAGAAACAAATAGACCCCCGGATCTCTCTAATCTCCAAAGGAGGATAAAAGAAATT
GTTCGGGTGCTCTCAAATTTCAAAGTCATTGAGGcAAGAAATTGTGACACGTAAGGATTACGTTGATCAACTTAAAAGGGACTTGGGTTC
ATATTATGGATACAATGATTTTCTCTTTGGATCXGTAAGTGGAGCTGTTTcCCCCTGTTGAGTTGATTGAACTTATTGaACTATTTTGAA
AGCCCCGGCCCAATTTTCTCTGGGGACAAACACTTTAAAGAATCgCAGACGGGATTTAGCAGGTGTTCTTCCTAAXCAAAAGGTGTCAAT
TTTGAATCCACTAAACAAAGGGTCAAAGGGTGGGGCTAGTTGTXATATAATTCCTAGGTTCCCGTTGGGGCCACCTCCGGAGAAAATGGC
GGGTGCACCACTTGCTCCAAAGGGGAGATTCCATTTCCGGCCGGAAGGGGCCCTTGCCCCTCCAAAAAAAGAAAGTTTTGTTGAATATGG
GGTCGCCTCCGGGAGGAAAAAATCTTTGTTGGCTGCXGCGGGGGAAAAAATGTGGTATTTTTTTCGCAATGAGAAGAGAGGGCCGGGACT
TAATCTCTCCGTGCATACCTATATGGAGGGGGGTAACAACACCACTCTTCGTACACTGAGTGAAAGAAGATCCTTAGATGtGGTCGTACA
CATCGCCGAATAATTTCGCGGAGATCCCCGCAGCGCGCGGTGGGTTCTCAGGAGAGATTGTGATAACTCAACACGTGGAATATAACAATC
TCACGCCTACXGAGAATACACTGCACTATGATAGCATACCAACACAGGGCGATATA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan