ESTScan Details for Unigene SGN-U344042

Score 
323
Direction 
Forward
Predicted Peptide Sequence 
IKAGSSPAVGAALEPSGSPXAAGCDKVKIGDLGFATIVGKSHSAHSVLGTPEFMAPELYDEDYTELIDIYSFGMCVLEMVTLELPYSECD
NVVKIYKKVISGVRPKAMDKVKDLEVKKFIEKCLAQPRVRPSASELLQDPFFNDINDDDENDDEEYTSNNYWHA
Predicted Coding Sequence 
XGCATTAAAGCTGGAAGCTCCCCCGCGGTGGGCGCCGCTCTAGAACCTAGTGGATCCCCCGXGGCTGCAGGTTGTGATAAGGTTAAGATT
GGTGATTTGGGTTTTGCAACTATAGTAGGGAAGAGTCATTCAGCACATTCGGTTCTTGGAACCCCAGAGTTCATGGCACCGGAGTTGTAT
GATGAGGATTATACCGAGCTGATTGATATCTACTCGTTTGGGATGTGTGTTTTGGAGATGGTGACGTTGGAACTACCTTATAGTGAGTGT
GATAACGTGGTGAAGATATACAAGAAGGTAATATCCGGAGTGAGGCCCAAGGCCATGGACAAGGTTAAAGATCTCGAGGTCAAGAAGTTC
ATTGAGAAGTGTCTTGCTCAGCCTAGGGTTAGACCCTCTGCTTCTGAACTCCTTCAAGACCCTTTCTTTAATGATATTAATGATGATGAC
GAAAACGACGATGAAGAGTATACTAGTAACAACTATTGGCATGCTTAA
Edits in Original Sequence 
(5')XGCATTAAAGCTGGAAGCTCCCCCGCGGTGGGCgGCCGCTCTAGAACCTAGTGGATCCCCCGXGGCTGCAGGTTGTGATAtAGGTT
AAGATTGGTGATTTGGGTTTTGCAACTATAGTAGGGAAGAGTCATTCAGCACATTCGGTTCTTGGAACCCCAGAGTTCATGGCACCGGAG
TTGTATGATGAGGATTATACCGAGCTGATTGATATCTACTCGTTTGGGATGTGTGTTTTGGAGATGGTGACGTTGGAACTACCTTATAGT
GAGTGTGATAACGTGGTGAAGATATACAAGAAGGTAATATCCGGAGTGAGGCCCAAGGCCATGGACAAGGTTAAAGATCTCGAGGTCAAG
AAGTTCATTGAGAAGTGTCTTGCTCAGCCTAGGGTTAGACCCTCTGCTTCTGAACTCCTTCAAGACCCTTTCTTTAATGATATTAATGAT
GATGACGAAAACGACGATGAAGAGTATACTAGTAACAACTATTGGCATGCTTAA(3')TGGTGTTGATTTGTTACTTATAGTGGTTTTTG
CCTTTTCTTCCAAAAAGAAGAAAGAAAATGGTTTTGCTTTTTATGAAACTATTGTAAAAGAAAAAACAATAGAAAAAAGAGTGTATTTTT
ATT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan