ESTScan Details for Unigene SGN-U344063

Score 
708
Direction 
Forward
Predicted Peptide Sequence 
MVLINGRAESIHSYKRITGFVAQDDIVHGNLTVEENLRFNARCRLAADLPKADKVLVVERVIESLGLQAVRDSLVGTVEKRGISGGQRKR
VNVGMEMVMEPSLLILDEPTSGLDSSSSNLLLKALRREALEGVKHLHGSSPAKLYLVQDVDDLVLLAKGGLVAYHGPVKKAEEYFANLGI
AVPDRVNPPDHFIDVLEGMVKPGGGVTVEQLPVRWMLHNGYPVPPDMMQLCDQIAMSXQGCASAPDXSFSXEAWHEKRDLX
Predicted Coding Sequence 
ATGGTTCTCATAAATGGAAGGGCAGAATCTATCCACTCATACAAGAGAATTACAGGTTTTGTTGCCCAAGATGATATAGTCCACGGAAAC
CTCACTGTAGAAGAGAACCTTCGATTTAATGCAAGATGCAGACTAGCTGCAGACTTGCCAAAGGCTGATAAGGTTCTTGTAGTCGAGAGA
GTTATTGAATCATTGGGTCTTCAGGCAGTTAGAGATTCACTGGTTGGGACTGTAGAGAAGCGTGGAATTTCTGGTGGCCAGAGGAAACGA
GTGAACGTGGGGATGGAAATGGTCATGGAACCTTCACTGCTAATCTTGGATGAACCTACATCTGGTTTAGACAGCTCATCCTCAAACTTA
CTTCTTAAAGCTCTTAGACGTGAAGCTCTTGAAGGTGTXAAACATTTGCATGGTTCTTCACCAGCCAAGCTATACCTTGTACAAGATGTT
GATGACTTGGTACTTCTAGCCAAAGGTGGTCTTGTTGCATATCACGGCCCTGTGAAGAAAGCAGAAGAATACTTTGCAAATCTGGGAATC
GCAGTACCAGATCGTGTAAATCCTCCTGACCATTTCATTGACGTCCTTGAGGGTATGGTCAAACCAGGTGGAGGTGTGACCGTGGAACAA
CTTCCTGTCCGATGGATGCTTCATAATGGTTACCCTGTACCCCCAGATATGATGCAATTGTGCGATCAGATTGCAATGTCCNTCCAGGGG
TGTGCATCAGCTCCTGACCNATCTTTTTCTGNTGAAGCATGGCATGAGAAGCGAGATCTCTXX
Edits in Original Sequence 
GGCAAGCTAACACAATGCACATTATCTGGGATGGTTCTCATAAATGGAAGGGCAGAATCTATCCACTCATACAAGAGAATTACAGGTTTT
GTTGCCCAAGATGATA
(5')ATGGTTCTCATAAATGGAAGGGCAGAATCTATCCACTCATACAAGAGAATTACAGGTTTTGTTGCCCAAG
ATGATATAGTCCACGGAAACCTCACTGTAGAAGAGAACCTTCGATTTAATGCAAGATGCAGACTAGCTGCAGACTTGCCAAAGGCTGATA
AGGTTCTTGTAGTCGAGAGAGTTATTGAATCATTGGGTCTTCAGGCAGTTAGAGATTCACTGGTTGGGACTGTAGAGAAGCGTGGAATTT
CTGGTGGCCAGAGGAAACGAGTGAACGTGGGGATGGAAATGGTCATGGAACCTTCACTGCTAATCTTGGATGAACCTACATCTGGTTTAG
ACAGCTCATCCTCAAACTTACTTCTTAAAGCTCTTAGACGTGAAGCTCTTGAAGGTGTXAAACATTTGCATGGTTCTTCACCAGCCAAGC
TATACCTTGTACAAGATGTTcGATGACTTGGTACTTCTAGCCAAAGGTGGTCTTGTTGCATATCACGGCCCTGTGAAGAAAGCAGAAGAA
TACTTTGCAAATCTGGGAATCGCAGTACCAGATCGTGTAAATCCTCCTGACCATTTCATTGACGTCCTTGAGGGTATGGTCAAACCAGGT
GGAGGTGTGACCGTGGAACAACTTCCTGTCCGATGGATGCTTCATAATGGTTACCCTGTACCCCCAGATATGATGCAATTGTGCGATCAG
ATTGCAATGTCCNTCCAGGGGTGTGCATCAGCTCCTGACCNATCTTTTTCTGNTGAAGCATGGCATGAGAAGCGAGATCTCTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan