ESTScan Details for Unigene SGN-U344068

Score 
-310
Direction 
Forward
Predicted Peptide Sequence 
MVVVYQSHLECRVVPDTENEHFQLEKKSPNGASRSFWDWIKINKYATPLNLKFKPNGIVGFSKKSSKYGITFPGPLLRLKTQLLSLSGGP
XYPIRPIVSRITIHWPSFYNVVTGKTLALPNXNRLAAHPPFASWRNSEEARTDRPSQQLRSLNGEWQIVSVNILLKFALIFVKSAHFLTN
RPKSAKSLINQKNRPEIGLSVVPVWNKSPLFKNVDPTSKGEKPSIRAMAHYVDHHP
Predicted Coding Sequence 
ATGGTTGTCGTGTACCAATCACATCTAGAGTGTAGAGTCGTGCCTGACACAGAAAACGAACATTTCCAACTTGAGAAAAAGTCTCCGAAT
GGAGCATCAAGAAGTTTTTGGGATTGGATAAAAATAAACAAATATGCTACCCCACTAAACTTGAAATTCAAACCCAATGGAATCGTTGGA
TTTTCCAAAAAGAGTTCAAAATATGGAATTACCTTCCCXGGACCACTTTTAAGGCTTAAAACTCAACTTCTCTCTCTCTCGGGGGGGCCC
GXGTACCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCC
AACTTXAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGC
AGCCTGAATGGCGAATGGCAAATTGTAAGCGTTAATATTTTGTTAAAATTCGCGTTAATTTTTGTTAAATCAGCTCATTTTTTAACCAAT
AGGCCGAAATCGGCAAAATCCCTTATAAATCAAAAGAATAGACCXGAGATAGGGTTGAGTGTTGTTCCAGTTTGGAACAAGAGTCCACTA
TTTAAGAACGTGGATCCNACGTCAAAGGGCGAAAAACCGTCTATCAGGGCGATGGCCCACTACGTNGACCATCACCCCTAA
Edits in Original Sequence 
GCCAGCAATGGTTGTCGTGTACCAATCACATCTAGAGTGTAGAGTCGTGCCGTGACACAGAAAACGAACATTTCCAACT(5')ATGGTTG
TCGTGTACCAATCACATCTAGAGTGTAGAGTCGTGCCgTGACACAGAAAACGAACATTTCCAACTTGAGAAAAAGTCTCCGAATGGAGCA
TCAAGAAGTTTTTGGGATTGGATAAAAATAAACtAAATATGCTACCCCACTAAACTTGAAATTCaAAACCCAATGGAATCGTTGGATTTT
CCAAAAAGAGTTCAAAATATGGAATTACCTTCCCXGGACCACTTTTAAGGCTTAAAACTCAACTTCTCTCTCTCTCGGGGGGGCCCGXGT
ACCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACT
TXAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCAGCC
TGAATGGCGAATGGCAAATTGTAAGCGTTAATATTTTGTTAAAATTCGCGTTaAATTTTTGTTAAATCAGCTCATTTTTTAACCAATAGG
CCGAAATCGGCAAAATCCCTTATAAATCAAAAGAATAGACCXGAGATAGGGTTGAGTGTTGTTCCAGTTTGGAACAAGAGTCCACTATTT
AAGAACGTGGAcTCCNACGTCAAAGGGCGAAAAACCGTCTATCAGGGCGATGGCCCACTACGTNGACCATCACCCCTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan