ESTScan Details for Unigene SGN-U344157

Score 
240
Direction 
Forward
Predicted Peptide Sequence 
APPSKQTPPANANANPTAVPVLASFIYGQLANLTKVFHKDITQVLGFCIDDVDAELFEAFNFAKNLEFLNNCFKETKDVTQRLCNAAEMK
FYFSSFLETKLSPKANXLKNPIGNCKLDIHX
Predicted Coding Sequence 
GCACCTCCTAGTAAACAAACTCCTCCTGCTAATGCTAATGCTAATCCTACTGCTGTGCCTGTTCTTGCATCTTTCATTTATGGCCAACTT
GCAAATCTTACAAAAGTATTCCATAAGGATATCACCCAGGTTTTGGGATTTTGCATTGATGATGTGGATGCTGAGTTGTTTGAGGCATTT
AATTTTGCCAAAAACTTGGAATTCTTAAATAATTGCTTTAAAGAGACCAAAGACGTGACACAGAGGCTATGTAACGCTGCAGAGATGAAA
TTCTACTTTTCAAGTTTTTTGGAGACAAAATTAAGTCCAAAAGCTAATXATCTTAAAAACCCAATAGGAAATTGTAAACTTGACATTCAT
GXX
Edits in Original Sequence 
CCTATTCTATTGAAAAATTTCATCTTTTTGGTTCTTGGGTTGTTTCTATTTCCATTTTATTGAAGAAAAAAAATCATCTTTTTGGTTCTT
TGTGTTGTTTCAGTTTTCTTGTAAAATATCCTTCATCCCTTGAAAAATTTCCACTTTTTGGCTTCTTGGGGTTGTTTCTATTTTTTAGTT
TATTCAGTTTTATGTTTTATTTAGTGGTGGCATTAATCTTCTTTAGGAATTAATTTATTTGGAATATTAGATGAAATGGGTAAAGTTAGG
ATATGGTTACCCATTTATTATTTGTTTATGATTCTTGTTTTGGGTTTTTCTCCATGTGTTTGGTGTGCACCTCCTAGTAAACAAACTCCT
CCTGCTAATGCTAATGCTAATCCTACTGCTGTGCCTGTTCTTGCATCTTTCATTTATGGCCAACTTGCAAATCTTACAAAAGTATTCCAT
AAGGATATCACCCAGGTTTTGGGATTTTGCATTGATGATGTGG
(5')GCACCTCCTAGTAAACAAACTCCTCCTGCTAATGCTAATGCTA
ATCCTACTGCTGTGCCTGTTCTTGCATCTTTCATTTATGGCCAACTTGCAAATCTTACAAAAGTATTCCATAAGGATATCACCCAGGTTT
TGGGATTTTGCATTGATGATGTGGATGCTGAGTTGTTTGAGGCATTTAATTTTGCCAAAAACTTGGAATTCTTAAATAATTGCTTTAAAG
AGACCAAAGACGTGACACAGAGGCTATGTAACGCTGCAGAGATGAAATTCTACTTTTCAAGTTTTTTGGAGACAAAATTAAGTCCAAAAG
CTAATXATCTTAAAAACCCAATAGGAAATTGTAAACTTGACATTCATGXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan