ESTScan Details for Unigene SGN-U344219

Score 
381
Direction 
Reverse
Predicted Peptide Sequence 
LKSLTCLPETVADKQSGRYSAGRREGLSVAIQLMEIPKVVYLDEPSTGLDPASRDTLWTVVKNARKGRAIILTTHSMEEADYLCDRLGIF
VDGSLQCIANSSELKTRYGGSYVLAITTSADNEVEVEKMVRQICPNANKVYHLSGTQKFELPKHESKIADVFQLVENAKSRFPIYAWGMA
DTTLEDVFIKVAACAQSFNEA
Predicted Coding Sequence 
CTTAAGAGTCTCACTTGTTTACCGGAGACXGTTGCTGACAAGCAATCTGGGAGATATAGTGCTGGAAGAAGAGAAGGXCTAAGTGTTGCT
ATTCAACTCATGGAAATCCCCAAGGTTGTCTACCTGGATGAGCCGAGTACTGGACTTGATCCAGCTTCAAGAGATACCTTATGGACTGTT
GTGAAGAATGCACGGAAAGGCAGAGCGATAATTCTCACTACCCATTCAATGGAAGAAGCGGATTATTTATGTGATCGCTTAGGAATCTTC
GTTGATGGAAGCTTGCAATGCATAGCAAATTCATCAGAGTTGAAGACAAGATATGGAGGGTCTTACGTGCTCGCGATAACTACATCAGCT
GATAATGAGGTGGAAGTGGAGAAAATGGTGCGACAGATATGCCCAAATGCCAACAAAGTGTATCATTTATCAGGTACACAGAAGTTCGAG
TTGCCAAAACATGAATCGAAAATTGCAGATGTATTTCAACTAGTTGAGAATGCAAAGAGTAGATTTCCAATTTATGCTTGGGGTATGGCT
GATACAACTTTAGAGGATGTTTTTATCAAGGTTGCTGCTTGTGCTCAATCCTTTAATGAAGCATGA
Edits in Original Sequence 
(5')CTTAAGAGTCTCACTTGTTTACCGGAGACXGTTGCTGACAAGCAATCTGGGAGATATAGTGCTGGAAGAAGAGAAGGXCTAAGTGT
TGCTATTCAACTCATGGAAATCCCCAAGGTTGTCTACCTGGATGAGCCGAGTACTGGACTTGATCCAGCTTCAAGAGATACCTTATGGAC
TGTTGTGAAGAATGCACGGAAAGGCAGAGCGATAATTCTCACTACCCATTCAATGGAAGAAGCGGATTATTTATGTGATCGCTTAGGAAT
CTTCGTTGATGGAAGCTTGCAATGCATAGCAAATTCATCAGAGTTGAAGACAAGATATGGAGGGTCTTACGTGCTCGCGATAACTACATC
AGCTGATAATGAGGTGGAAGTGGAGAAAATGGTGCGACAGATATGCCCAAATGCCAACAAAGTGTATCATTTATCAGGTACACAGAAGTT
CGAGTTGCCAAAACATGAATCGAAAATTGCAGATGTATTTCAACTAGTTGAGAATGCAAAGAGTAGATTTCCAATTTATGCTTGGGGTAT
GGCTGATACAACTTTAGAGGATGTTTTTATCAAGGTTGCTGCTTGTGCTCAATCCTTTAATGAAGCATGA(3')TTGCCTTAATTAGGAA
ATATTTAGGTTCATGTAGATATATCAAGTACAGAGCAAATGTGACTCCTATTTTGTCATGTAAATTGTGTACAATGATGCCAATCTCTGG
CGTTTTGTTCGTGGAATAGAAAGAGTTTGTTGTATCAACGTATTT

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan