ESTScan Details for Unigene SGN-U344252

Score 
161
Direction 
Forward
Predicted Peptide Sequence 
NSWSSTAVSAALELVDPRAAGSNSDEMPXVFDIVKPSHLCLVNPTAALQALSVQVALPTPKHLESVLHYFAPIHVKTNAQVRDMSARS
Predicted Coding Sequence 
AATAGCTGGAGCTCCACCGCGGTGTCGGCCGCTCTAGAACTAGTGGATCCCCGGGCTGCAGGCAGCAATTCGGATGAAATGCCTXTTGTT
TTTGACATCGTCAAGCCTTCACATCTTTGCCTTGTCAATCCAACAGCTGCCTTGCAAGCCTTGAGTGTTCAAGTTGCTTTGCCAACACCC
AAGCACCTTGAATCTGTGTTGCACTATTTTGCCCCCATTCATGTCAAGACCAATGCCCAAGTCCGTGACATGTCTGCACGTAGTTAG
Edits in Original Sequence 
(5')AATAGCTGGAGCTCCACCGCGGTGTCGGCCGCTCTAGAACTAGTGGATcCCCCGGGCTGCAGGCAGCAATTCGGATGAAATGCCTX
TTGTTTTTGACATCGTCAAGCCTTCACATCTTTGCCTTGTCAATCCAACAcGCTGCCTTGCtAAGCCTTGAGTGTTCAAGTTGCTTTGCC
AACACCCAAGCACCTTGAATCTGTGTTGCACTATTTTGCCCCCATTCATGTCAAGACCAATGCCCAAGTCCGTGACATGTCTGCACGTAG
TTAG(3')AAATTTTGCAAGTTAAGCTAAGTATGAGTTTTGGGTAAACTTCAAATGACCATAACTCATGTCACAGGATGAGTTAGGTGTG
CTAAAAGATACCATAGGAAATGTCTTTGAATTATCTTTCCAACGCCACCATGTTTGCTAATTTTAAAGTCCGGATGAGTAAGATATGACC
TTTTGAATTTAGGTTGTCTAGTTAAGGAAAGTCATTCAAAAATAGTGAGGGCTATTTTGGTCCTTTCCTTACCCAATTAGATTTAAATTC
GTTTGTAGTTATATTTTAGGGTTATAATCCTTTTAGGTTCACTTTTAAAATCGTAATATACACCTAGGGTTTTAGTTGAGAGTTCAAGAA
AAGGCAAGAAGAGAAAAGAAGAGAAAAGAGGAGAAAGGATGAAGGTGTTCAACGACCTTCTGGAGTTTAGTTGCGGATTTTTGCCATGAG
TTTAATCCCAAAGAGGCATGTATAAGTATAA

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan