ESTScan Details for Unigene SGN-U344318

Score 
173
Direction 
Forward
Predicted Peptide Sequence 
DYSPAQLLPYSAAAPPALPPHHRQAQTKAHSFSVSFHFIHHYSSISAPILISMGFRFRFSCNSLKYYAELASKLAQDGRFDDSMMIAESV
EVSGVNAEEFTALKNVKWASGGIDRLLGERRVGSVVELLSGAQQLGIDPSKLLDEDSINALSESVDGLCNAAEIDEGVSLMETLRGVGMP
INDLVNPSEILRPCVSQRKPKAAIRYAHYLFXKWDIMVWTPKFLEIGKXKGRMGGLVLNGLGKAAQGGNP
Predicted Coding Sequence 
GATTACTCTCCCGCCCAACTCCTTCCCTACTCCGCCGCCGCACCACCGGCACTACCGCCGCACCACCGCCAAGCCCAAACGAAAGCCCAC
TCATTCTCCGTCTCATTTCACTTCATCCATCACTACTCCTCAATCTCCGCTCCTATCCTCATTTCGATGGGATTCCGCTTCCGCTTCAGC
TGTAATAGTCTTAAATACTATGCTGAGTTGGCGTCTAAGCTAGCGCAGGATGGGAGGTTCGATGATTCGATGATGATCGCCGAGAGTGTT
GAGGTTTCTGGAGTGAATGCGGAGGAATTCACAGCGTTGAAGAATGTGAAGTGGGCTTCCGGTGGGATTGATCGATTGCTTGGGGAAAGG
AGGGTAGGGAGTGTTGTTGAGCTTCTGAGTGGCGCTCAGCAACTTGGAATCGATCCTTCGAAGCTTCTTGATGAAGATTCAATAAATGCC
CTTTCCGAGAGTGTAGACGGACTATGCAATGCAGCXGAAATTGACGAAGGTGTGAGCCTGATGGAAACACTTAGAGGXGTGGGTATGCCA
ATTAACGATTTGGTGAACCCATCTGAGATTCTAAGACCTTGTGTCAGCCAAAGAAAGCCCAAAGCCGCAATAAGGTATGCACATTATCTT
TTCXACAAGTGGGACATTATGGTCTGGACCCCTAAATTTTTGGAAATTGGAAAGAXGAAAGGCCGAATGGGCGGTCTGGTTCTAAACGGG
CTTGGGAAGGCAGCCCAAGGCGGAAACCCG
Edits in Original Sequence 
GATTACTCTCCCGCCCAACTCCTTCCCTACTCCGCCGCCGCACCACCGGCACTACCGCCGCACCACCGCCAAGCCCAAACGAAAGCCCAC
TCATTCTCCGTCTCA
(5')GATTACTCTCCCGCCCAACTCCTTCCCTACTCCGCCGCCGCACCACCGGCACTACCGCCGCACCACCGCCA
AGCCCAAACGAAAGCCCACTCATTCTCCGTCTCATTTCACTTCATCCATCACTACTCCTCAATCTCCGCTCCTATCCTCATTTCGATGGG
ATTCCGCTTCCGCTTCAGCTGTAATAGTCTTAAATACTATGCTGAGTTGGCGTCTAAGCTAGCGCAGGATGGGAGGTTCGATGATTCGAT
GATGATCGCCGAGAGTGTTGAGGTTTCTGGAGTGAATGCGGAGGAATTCACAGCGTTGAAGAATGTGAAGTGGGCTTCCGGTGGGATTGA
TCGATTGCTTGGGGAAAGGAGGGTAGGGAGTGTTGTTGAGCTTCTGAGTGGCGCTCAGCAACTTGGAATCGATCCTTCGAAGCTTCTTGA
TGAAGATTCAATAAATGCCCTTTCgCGAGAGTGTAGACGGACTATGCAATGCAGCXGAAATTGACGAAGGTGTGAGCCTGATGGAAACAC
TTAGAGGXGTGGGTATGCCAATTAACGATTTGGTGAACCCATCTGAGATTCTAAGACCTTGTGTCAGCCAAAGAAAGCCCAAAGCCGCAA
TAAGGTATGCACATTATCTTTTCXACAAGTGGGACATTATGGTCTGGACCCCTAAATTTTTGGAAATTGGAAAGAXGAAAGGCCGAATGG
GCGGTCTGGTTCTAAACGGGCTTGGGAAGGCAGCCCAAGGCGGAAACCCG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan