ESTScan Details for Unigene SGN-U344321

Score 
411
Direction 
Reverse
Predicted Peptide Sequence 
MICGKDLTVLSTWDPFLVKILFXLKGEFPGEYGRDTGGFFGDPEAFSKKRGFGVFPGRWAMLGALGCIFPEIFEKRGKVDFKEPVWFKAG
LQIFRGGGLEYLGNPNLVKVRXILSVVGFQRGVLGLFEGFRINGIPGVGEGKDFFPGGQYFDPLGLGGGPSPFGEIKVKEIKKGRLGMFS
KFGFFVQGIVTGKGPFENLFDPLDNPVGNKGWVFAPKFVPGG
Predicted Coding Sequence 
ATGATTTGTGGTAAGGACCTGACCGTGTTAAGTACTTGGGACCCTTTTTTGGTCAAAATCCTTTTTAAXTTGAAAGGAGAGTTTCCTGGG
GAATACGGAAGGGACACTGGTGGTTTTTTCGGTGATCCCGAGGCCTTTTCCAAAAAAAGAGGTTTTGGGGTTTTCCCTGGAAGATGGGCA
ATGCTTGGTGCCCTAGGTTGCATTTTTCCCGAAATTTTTGAAAAAAGGGGGAAGGTTGACTTTAAAGAACCCGTTTGGTTTAAAGCAGGA
TTACAAATTTTCCGTGGCGGGGGACTTGAATACTTGGGAAACCCTAACCTTGTCAAGGTTAGAGXTATTTTAAGTGTGGTAGGTTTTCAA
AGGGGGGTTTTGGGACTTTTTGAAGGTTTTAGAATTAACGGAATTCCCGGGGTTGGGGAAGGGAAAGACTTTTTCCCCGGGGGGCAATAT
TTTGACCCCCTTGGCCTTGGGGGTGGCCCTTCCCCATTTGGTGAAATCAAGGTAAAGGAAATTAAAAAAGGGAGGCTAGGTATGTTTTCC
AAGTTTGGATTTTTTGTTCAAGGTATTGTTACCGGGAAAGGCCCTTTTGAAAACCTTTTTGATCCCCTTGACAACCCTGTGGGTAACAAA
GGTTGGGTTTTCGCCCCTAAGTTTGTTCCCGGGGGTTAG
Edits in Original Sequence 
TAATGATTTGTGGTAAGGACCTGACCGTGTTAAGTACTTGGGACCCTTTTTTGGTCAAAATCCTTTTTAATTGAAAGGAGAGTTTCCTGG
GGAATACGGAAGGGACACTGGTGGTTTTTTCGGTGATCCCGAGGCCTTTTCCAAAAAAAGAGGTTTTGGGGTTTTCCCTGGAAGATGGGC
AATGCTTGGTGCCCTAGGTTGCATTTTTCCCGAAATTTTTGAAAAAAGGGGGAAGGTTGACTTTAAAGAACCCGTTTGGTTTAAAGCAGG
ATTACAAATTTTCCGTGGCGGGGGACTTGAATACTTGGGAAAC
(5')ATGATTTGTGGTAAGGACCTGACCGTGTTAAGTACTTGGGACC
CTTTTTTGGTCAAAATCCTTTTTAAXTTGAAAGGAGAGTTTCCTGGGGAATACGGAAGGGACACTGGTGGTTTTTTCGGTGATCCCGAGG
CCTTTTCCAAAAAAAGAGGTTTTGGGGTTTTCCCTGGAAGATGGGCAATGCTTGGTGCCCTAGGTTGCATTTTTCCCGAAATTTTTGAAA
AAAGGGGGAAGGTTGACTTTAAAGAACCCGTTTGGTTTAAAGCAGGATTACAAATTTTCCGTGGCGGGGGACTTGAATACTTGGGAAACC
CTAACCTTGTcCAAGGTTAGAGXTATTTTAAGTGTGGTAGGTTTTCAAAGGGGGGTTTTGGGACTTTTTGAAGGTTTTAGAATTAACGGA
ATTCCCGGGGTTGGGGAAGGGAAAGACTTTTTCCCCGGGGGGCAATATTTTGACCCCCTTGGCCTTGGGGGTGGCCCTTCCCCATTTGGT
GAAATCAAGGTAAAGGAAATTAAAAAAGGGAGGCTAGGTATGTTTTCCAAGTTTGGATTTTTTGTTCAAGGTATTGTTACCGGGAAAGGC
CCTTTTGAAAACCTTTTTGATCCCCTTGACAACCCTGTGGGTAACAAAGGTTGGGTTTTCGCCCCTAAGTTTGTTCCCGGGGGTTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan