ESTScan Details for Unigene SGN-U344350

Score 
168
Direction 
Reverse
Predicted Peptide Sequence 
MSGGIXYLYGLKAIKAKALADILRKSLXMXSXDPLKPYFHNEEVSFVGTNISEAYLDWRLFVDGAANHQGKGIGAVLVSNSGQHYPMEEK
LQFNYTNNMAEYEACIQVFKWPSDMNVHELLVISDSDLLIYEVQGEWAVKNPKIIAYMQHVQNYARDFVGSSLDXTPRIQNVLADALATI
ASMIKHLDIDYIDLVDIELKEHPVHCSHVEAEQEGLCWYSDIKNIWGXGIYLEVATLSGEVLYSITPYLGLP
Predicted Coding Sequence 
ATGTCTGGAGGAATTTGATATTTGTATGGACTCAAGGCCATAAAGGCAAAAGCCTTAGCTGATATCTTAAGAAAATCCCTANTTATGAGN
AGTXATGACCCACTTAAGCCCTATTTTCATAATGAAGAAGTGTCATTCGTGGGTACAAATATTTCTGAAGCATATCTCGACTGGAGACTA
TTCGTTGATGGAGCGGCGAATCATCAAGGGAAAGGCATCGGAGCGGTTTTAGTGTCAAATTCTGGTCAACACTATCCCATGGAAGAAAAA
CTCCAATTTAATTACACGAACAACATGGCTGAGTATGAAGCTTGTATCCAGGTTTTTAAATGGCCATCXGACATGAATGTCCACGAGTTG
TTGGTTATTTCAGATTCAGATCTTTTGATTTATGAAGTTCAAGGAGAATGGGCTGTGAAGAACCCGAAGATTATAGCTTACATGCAGCAT
GTACAGAACTATGCAAGAGATTTCGTAGGATCGAGTTTAGACATXACTCCTAGAATACAAAATGTGTTAGCTGATGCCCTTGCCACTATC
GCTTCAATGATCAAACATCTAGACATTGATTATATTGATCTTGTTGATATAGAGCTAAAAGAACACCCAGTCCATTGTTCACATGTTGAG
GCAGAACAAGAAGGATTGTGTTGGTACTCTGATATAAAAAATATTTGGGGTXCTGGTATTTATCTAGAAGTTGCTACTCTAAGTGGAGAA
GTTCTTTATAGTATAACTCCATATTTGGGTCTCCCTTGA
Edits in Original Sequence 
TTCATAATGAAGAAGTGTCATTCGTGGGTACAAATATTTCTGAAGCA(5')ATGTCTGGAGGAATTTGATATTTGTATGGACTCAtAGGC
CATAAAGGCAAAAGCCTTAGCTGATATCTTAAGAAAATCCCTANTTATGAGNAGTXATGACCCACTTAAGCCCTATTTTCATAATGAAGA
AGTGTCATTCGTGGGTACAAATATTTCTGAAGCATATCTCGACTGGAGACTATTCGTTGATGGAGCGGCGAATCATCAAGGGAAAGGCAT
CGGAGCGGTTTTAGTGTCAAATTCTGGTCAACACTATCCCATGGAAGAAAAACTCCAATTTAATTACACGAACAACATGGCTGAGTATGA
AGCTTGTATCCAcGGTTTTTAAATGGCCATCXGACATGAATGTCCACGAGTTGTTGGTTATTTCAGATTCAGATCTTTTGATTTATGAAG
TTCAAGGAGAATGGGCTGTGAAGAACCCGAAGATTATAGCTTACATGCAGCATGTACAGAACTATGCAAGAGATTTCGTAGGATCGAGTT
TAGACATXACTCCTAGAATACAAAATGTGTTAGCTGATGCCCTTGCCACTATCGCTTCAATGATCAAACATCTAGACATTGATTATATTG
ATCTTGTTGATATAGAGCTAAAAGAACACCCAGTCCATTGTTCACATGTTGAGGCAGAACAAGAAGGATTGTGTTGGTACTCTGATATAA
AAAATATTTGGGGTXCTGGTATTTATCTAGAAGTTGCTACaTCTAAGTGGAGAAGTTCTTTATAGTATAACTCCATATTTGGGTCTCCCT
TGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan