ESTScan Details for Unigene SGN-U344395

Score 
304
Direction 
Reverse
Predicted Peptide Sequence 
MGFCDPCPGEPKQLYVEYTFDGNNFEVIVDDLDELLIPQESHXNLMTSXAAESPFFTSLNIDLRLLIPPDENLRQPIEKLVTSSNFASIY
ASEVLFAQCYYPSLPFLSSLPSKPTGIRAWKTSRNRVFAPTLALEMLKWDAVP
Predicted Coding Sequence 
ATGGGATTTTGTGATCCTTGTCCTGGAGAACCCAAGCAATTGTATGTGGAGTACACCTTTGATGGTAACAACTTTGAGGTCATTGTCGAC
GATTTGGATGAGTTGCTTATACCCCAAGAATCACACAXGAATTTGATGACAAGTGXAGCTGCTGAGTCTCCGTTTTTCACTTCACTGAAT
ATAGATTTAAGACTGCTGATTCCTCCAGATGAGAATTTAAGGCAACCAATTGAGAAGCTTGTTACCTCTTCAAATTTTGCATCAATCTAT
GCCTCTGAAGTACTTTTTGCTCAATGTTACTACCCGTCGCTTCCCTTCTTGTCCTCTTTACCCTCCAAACCAACAGGAATAAGAGCGTGG
AAAACTAGCAGAAACAGAGTTTTCGCACCAACCCTAGCCTTAGAAATGTTAAAATGGGATGCAGTTCCTTAG
Edits in Original Sequence 
GGGATTTTGTGATCCTTGTCCTGGAGAACCCAAGCAATTGTATGTGGAGTACACCTTTGATGGTAACAACTTTGAGGTCATTGTCGACGA
TTTGGATGAGTTGCTTATACCCCAAGAATCACACAGAATTTGATGACAAGTGAGCTGCTGAGTCTCCGTTTTTCACTTCACTGAATATAG
ATTTAAGACTGCTGATTCCTCCAGATGAGTAATTTA
(5')ATGGGATTTTGTGATCCTTGTCCTGGAGAACCCAAGCAATTGTATGTGGA
GTACACCTTTGATGGTAACAACTTTGAGGTCATTGTCGACGATTTGGATGAGTTGCTTATACCCCAAGAATCACACAXGAATTTGATGAC
AAGTGXAGCTGCTGAGTCTCCGTTTTTCACTTCACTGAATATAGATTTAAGACTGCTGATTCCTCCAGATGAGtAATTTAAGGCAACCAA
TTGAGAAGaCTTGTTACCTCTTCAAATTTTGCATCAATCTATGCCTCTGAAGTACTTTTTGCTCAATGTTACTACCCGTCGCTTCCCTTC
TTGTCCTCTTTACCCTCCAAACCAACAGGAATAAGAGCGTGGAAAACTAGCAGAAACAGAGTTTTCGCACCAACCCTAGCCTTAGAAATG
TTAAAATGGGATGCAGTTCCTTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan