ESTScan Details for Unigene SGN-U344423

Score 
-273
Direction 
Forward
Predicted Peptide Sequence 
MGVKNQYLYFQCLNNFKKPFDLGDTDPVELFFTERGTPSRITFSGNRGILLELCFHYLSEFPSISGKLPRAKFLRPGGSTSSKTAATAVD
LHLLFPLPRVNFHLGVIMVIAVSCVKLLSAHNSTQHTNRKLKXVKPGVPNNDLPHINCVALTAPLSNQRNLSLPTCFNESAQPPGEKAGF
VLLGNSFRLSPLIDFPCPSGLFGWKANPEINLPFQGGVYNGFSHQKIPGPYPXQEKKPLCKQKGRPLKKGSRNPLKKGPTGWPLPLSLAG
EGLSYHTTFVT
Predicted Coding Sequence 
ATGGGAGTTAAAAATCAGTATCTATACTTCCAATGTTTAAACAATTTCAAGAAACCATTTGATCTTGGGGACACTGATCCGGTGGAACTG
TTCTTTACAGAACGAGGCACACCATCTCGTATAACCTTCTCCGGGAATAGAGGAATACTGCTTGAGCTATGTTTTCACTATCTGTCTGAA
TTCCCTTCTATAAGTGGGAAACTTCCTCGTGCCAAATTCCTGCGGCCCGGGGGATCCACTAGTTCTAAAACGGCCGCCACCGCGGTGGAC
CTCCATCTTTTGTTCCCTTTACCGAGGGTTAATTTCCACCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCGCT
CACAATTCCACACAACATACAAACCGGAAGCTTAAAGXTGTAAAGCCTGGGGTGCCTAATAATGACCTCCCTCACATTAATTGCGTTGCG
CTCACTGCCCCCCTTTCAAATCAGAGAAACCTGTCCTTGCCCACTTGCTTTAATGAATCGGCCCAACCCCCCGGGGAAAAGGCTGGTTTT
GTTTTATTGGGAAACTCTTTCCGGCTTTCCCCCTTAATTGACTTCCCTTGCCCCTCGGGTCTTTTCGGGTGGAAAGCGAACCCGGAAATA
AACCTTCCCTTCCAGGGGGGGGTATATAACGGGTTTTCCCACCAGAAAATACCGGGGCCCTACCCCXCCCAGGAAAAAAAACCTTTGTGT
AAGCAGAAAGGGCGCCCTCTCAAAAAGGGCTCTCGAAACCCCCTAAAAAAAGGGCCCACCGGATGGCCTTTGCCCCTCTCTCTTGCCGGA
GAAGGGCTTTCCTACCACACCACCTTTGTAACC
Edits in Original Sequence 
TTTTTTTTTTTTTTTTTTTTTTTTTCTCAACTCTGTATCTTACCGTTTTTTAAAAGGAAATCTATCAATTTCTTGTTTGTTCAACTTTCT
AATGGGGAAAAAAAATAACTGAAATCTCACGGAGACAAAAATACAACTGTACTGATCTCTAAAAAATGTTGATTTTACTTGATAGTGAGA
GTTCTGACGACCTTTCTTGATGTTGTTGATGAATTCATATTTTATGTCCGAAAGAAAATATTTAAGCTTGGAGAATTGGTCTTTCAACAG
TGATACTTAATGAACTCTCTTAAATAACCACGATGGGAGTTAAAAATCAGTAATCTATACTTC
(5')ATGGGAGTTAAAAATCAGTaATC
TATACTTCCAATGTTTAAACAATTTCAAGaAAACCATTTGATCTTGGGGACACTGATCCGGTGGAACTGTTCTTTACAGAACGAGGCACA
CCATCTCGTATAACCTTCTCCGGGAATAGAGGAATACTGCTTGAGCTATGTTTTCACTATCTGTCTGAATTCCCTTCTATAAGTGGGAAA
CTTaCCTCGTGCCAAATTCCTGCGGCCCGGGGGATCCACTAGTTCTAAAACGGCCGCCACCGCGGTGGACCTCCATCTTTTGTTCCCTTT
ACCGAGGGTTAATTTCCACCTTGGCGTAATCATGGTCATAGCTGTTTCCTGTGTGAAATTGTTATCCGCTCACAATTCCACACAACATAC
AAACCGGAAGCTTAAAGXTGTAAAGCCTGGGGTGCCTAATaAATGACCTCCCTCACATTAATTGCGTTGCGCTCACTGCCCCCCTTTCAA
ATCAGAGAAACCTGTCCTTGCCCACTTGCTTTAATGAATCGGCCCAACCCCCCGGGGAAAAGGCTGGTTTTGTTTTATTGGGAAACTCTT
TCCGGCTTTcCCCCCTTAATTGACTTCCCTTGCCCCTCGGGTCTTTTCGGGTGGAAAGCGAACCCGGAAATAAACCTTCCCTTCCAGGGG
GGGGTATATAACGGGTTTTCCCACCAGAAAATACCGGGGCCCTACCCCXCCCAGGAAAAAAAACCTTTGTGTAAGCAGAAAGGGCGCCCT
CTCAAAAAGGGCTCTCGAAACCCCCTAAAAAAAGGGCCCACCGGATGGCCTTTGCCCCTCTCTCTTGCCGGAGAAGGGCTTTCCTACCAC
ACCACCTTTGTAACC(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan