ESTScan Details for Unigene SGN-U344424

Score 
182
Direction 
Forward
Predicted Peptide Sequence 
MTNVVEEFDNVYVTQKAIKVHALADHFAETPVDEKYQLFKTYFHDEEVSFVGEDISEAYPGXRLFFDGASNHQGKGIGAVLVSKSGQHYP
MAAKLDLIAXNNITEYEAYILGLKMVVDINVHELLVIKDSDXVDSSSSGRVVHEEPQDYTLRTVCIKVXAKDFARLHSDTLPEYRMSWLI
LSQPLLLDLTSDNNYIDHMDIELKDIHSIXHMLKQNQTVCHGISYKEYLEX
Predicted Coding Sequence 
ATGACAAATGTTGTTGAGGAATTTGATAATGTGTATGTGACTCAGAAGGCGATAAAGGTACATGCCTTGGCTGATCATTTCGCAGAAACT
CCCGTTGACGAAAAATATCAGTTGTTCAAGACTTATTTTCATGATGAAGAAGTGTCATTTGTGGGTGAAGATATTTCTGAAGCGTACCCA
GGTTGAAGATTATTCTTTGATGGAGCGTCCAATCACCAAGGGAAAGGTATTGGAGCAGTTTTAGTGTCAAAATCTGGTCAACACTATCCC
ATGGCGGCTAAACTTGATTTAATTGCACXGAACAACATAACCGAATACGAAGCTTATATTCTTGGTTTGAAAATGGTTGTTGACATAAAT
GTCCACGAACTATTGGTCATCAAAGATTCAGATXCTGTTGATTCATCAAGTTCAGGGAGAGTGGTCCATGAAGAACCTCAAGATTATACC
TTACGTACAGTATGTATAAAAGTTGXAGCAAAAGATTTCGCAAGATTGCATTCAGACACACTCCCAGAATACAGAATGAGTTGGCTGATT
CTCTCACAACCATTGCTTCTTGATTTAACATCAGATAATAATTATATCGATCATATGGATATAGAGCTGAAAGACATCCATTCCATTGNT
CACATGTTGAAACAGAACCAGACGGTTTGCCATGGTATTTCATATAAAGAATATTTGGAANXX
Edits in Original Sequence 
TGAGACATTATCTATCTTCTTATACTACATACCTCATTTCCAGAATGGACCCGCTGAAGTATATCTTTCAGAAAGCGATGTCGATCGGAA
AATTAGCTAAATGACAAATGTTGTTGAGCGAATTTGATAATGTGTATGTG
(5')ATGACAAATGTTGTTGAGcGAATTTGATAATGTGTA
TGTGACTCAGAAGGCGATAAAGGTACATGCCTTGGCTGATCATTTCGCAGAAACTCCCGTTGACGAAAAATATCAGTTGTTCAAGACTTA
TTTTCATGATGAAGAAGTGTCATTTGTGGGTGAAGATATTTCTGAAGCGTACCCAGGTTGAAGATTATTCTTTGATGGAGCGTCCAATCA
CCAAGGGAAAGGTATTGGAGCAGTTTTAGTGTCAAAATCTGGTCAACACTATCCCATGGCGGCTAAACTcTGATTTAATTGCACXGAACA
ACATAACCGAATACGAAGCTTATATTCTTGGTTTGAAAATGGTTGTTGACATAAATGTCCACGAACTATTGGTCATCAAAGATTCAGATX
CTGTTGATTCATCAAGTTCAGGGAGAGTGGTCCATGAAGAACCTCAAGATTATACCTTACGTACAGTATGTATAAAAGTTGXAGCAAAAG
ATTTCGCAAGATTGCATTCAGACACACTCCCAGAATACAGAATGAGTTGGCTGATTCTCTCACAACCATTGCTTCTaTGATTTAACATCg
AGATAATAATTATATCGATCATATGGATATAGAGCTGAAAGACATCCATTCCATTGNTCACATGTTGAAACAGAACCAGACGGTTTGCCA
TGGTATTTCATATAAAGAATATTTGGAANXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan