ESTScan Details for Unigene SGN-U344442

Score 
100
Direction 
Forward
Predicted Peptide Sequence 
MGPFIHYIIKIWHFNILRAXVTNKTDALHFTNIVKSDXNRPIPKGNPSFPPAPHPKPGFPPVPPNLGNFHMVPHSALVIPWGLMVSQGKP
FRAQXPNSKPGTPPFFNXVPNFPEQFPARQNMNARTILVLHPVNWWPHLLPPDSSTLPSHGGNFPVFLPSPKSKSIXTFPHRRVQPG
Predicted Coding Sequence 
ATGGGGCCATTTATACATTACATAATTAAAATTTGGCATTTTAATATCCTTCGCGCTXTTGTAACCAATAAAACTGACGCCCTGCACTTT
ACAAACATTGTCAAATCCGATAAXAACCGACCCATCCCGAAGGGTAACCCTTCTTTCCCTCCCGCCCCTCACCCAAAACCTGGGTTCCCX
CCGGTGCCCCCAAACTTGGGCAACTTCCACATGGTCCCTCACTCCGCCCTCGTAATACCCTGGGGACTTATGGTATCCCAAGGAAAACCA
TTCCGTGCTCAGXTCCCGAATTCCAAACCAGGAACCCCTCCATTTTTCAATXACGTACCCAATTTCCCTGAACAATTCCCCGCCAGACAA
AACATGAATGCACGAACCATTCTCGTACTTCATCCTGTTAATTGGTGGCCACACCTCCTGCCACCTGACTCTTCCACCCTTCCTAGCCAT
GGAGGTAATTTCCCCGTTTTCCTTCCTTCACCCAAGTCAAAATCCATTGAXACTTTCCCCCATAGAAGGGTGCAACCAGGCTAA
Edits in Original Sequence 
AAATAAAACAAATGCCATTTATTCAAAAAATGAAGGGAACCCAACAAACTAAAATTACTACACTTTCTCCAAAAAAAAACTTTAAGGAGG
ATTCCAACAACCTTCCCCCAAAAACATGGGGCCATTTATACATTACATAATTAAAATTTGGCATTTTAATATCCTTCGCGCTTTGTAACC
AATAAAACTGACGCCCTGCACTTTACAAACATTGTCAAATCCGATAAAACCGACCCATCCCGAAGGGTAACCCTTCTTTCCC
(5')ATGG
GGCCATTTATACATTACATAATTAAAATTTGGCATTTTAATATCCTTCGCGCTXTTGTAACCAATAAAACTGACGCCCTGCACTTTACAA
ACATTGTCAAATCCGATAAXAACCGACCCATCCCGAAGGGTAACCCTTCTTTCCCTCCCGCCCCTCACCCAAAACCTGGGTTCCCXCCGG
TGCCCCCAAACTTGGGCAACTTCCACATGGTCCCTCACTCCGCCCTCGTAATACCCTGGGGACTTATGGTATCCCAAGGAAAACCATTCC
GTGCTCAGXTCCCGAATTCCAAACCAGGAACCCCTCCATTTTTCAATXACGTACCCAATTTCCCTGAACAATTCCCCGCCAGACAAAACA
TGAATGCACGAACCATTCTCGTACTTCATCCTGTTAATTGGTGGCCACACCTCCTGCCACCTGACTCTTCCACCCTTCCTAGCCATGGAG
GTAATTTCCCCGTTTTCCTTCCTTCACCCAAGTCAAAATCCATTGAXACTTTCCCCCATAGAAGGGTGCAACCAGGCTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan