ESTScan Details for Unigene SGN-U344583

Score 
194
Direction 
Forward
Predicted Peptide Sequence 
GIPXXXLGTDYLTLXPAPLAXXPPGWRYRTXGSPXAAGILHEAPLFNLNMLLGKAGKEILKKLNAWRLQPQDAQKHTVKERKKEKQMTAN
VLGHNVNGNVKASTMKGVKKAVNASANDAHQEDPLHETMNVPHPDFHNFDHDRSESCFEHNEVWASYDADDGMPRFYALINKVILREPFK
ARLSWLNSKTNTEFGPMEWVASGFYKTSGEVMIGRYETGXSREILLPQGSIGKRDLXGTVVKNPQKGDGWALLKNLIVAWKPNPTGWMYF
PSFKWALILWGIPQGTRGFQWPLFKSKWAGFKKTNFWSAI
Predicted Coding Sequence 
XXGGGAATCCCNNNNTTNNNTTTAGGAACGGACTACCTCACGTTANTACCCGCACCACTAGCTAANNCTCCCCCNGGTTGGCGNTATAGA
ACTAGNGGATCCCCCGXGGCTGCAGGAATTCTGCACGAGGCACCACTTTTTAATCTGAACATGCTGCTGGGGAAAGCTGGGAAAGAGATA
CTTAAGAAGTTGAATGCGTGGAGATTGCAGCCGCAAGATGCACAAAAACACACCGTAAAAGAGCGCAAAAAAGAAAAACAGATGACTGCT
AATGTTCTTGGTCATAATGTAAACGGGAATGTAAAGGCATCAACTATGAAGGGAGTAAAGAAAGCTGTCAATGCTTCAGCTAATGATGCA
CATCAAGAGGATCCACTGCACGAAACAATGAATGTACCACATCCTGATTTTCACAATTTCGATCACGATAGGAGCGAAAGTTGTTTTGAA
CACAATGAAGTCTGGGCTTCATATGATGCTGATGATGGCATGCCCCGTTTCTATGCTCTGATTAACAAAGTCATCTTAAGGGAACCATTT
AAAGCGAGGCTCAGTTGGCTTAATTCAAAAACGAACACTGAATTTGGTCCAATGGAGTGGGTAGCTTCAGGTTTCTATAAAACTTCTGGT
GAAGTTATGATTGGCAGATATGAAACGGGGXTAAGTCGTGAAATCCTTCTCCCACAAGGGTCAATTGGTAAAAGGGACCTCXGTGGAACG
GTTGTAAAAAATCCCCAAAAGGGGGATGGTTGGGCCCTTTTAAAAAATTTGATTGTTGCATGGAAGCCCAATCCAACTGGATGGATGTAT
TTCCCAAGTTTTAAATGGGCCCTAATTCTTTGGGGAATCCCACAGGGAACCAGGGGATTTCAATGGCCTCTCTTTAAATCCAAATGGGCT
GGGTTTAAAAAAACGAATTTTTGGTCCGCAATTTGA
Edits in Original Sequence 
(5')XXGGGAATCCCNNNNTTNNNTTTAGGAACGGACTACCTCACGTTANTACCCGCACCACTAcGCTAANNCTCCCCCNGGTTGGCGNT
ATAGAACTAGNGGATCCCCCGXGGCTGCAGGAATTCTGCACGAGGCACCACTTTTTAATCTGAACATGCTGCTGGGGAAAGCTGGGAAAG
AGATACTTAAGAAGTTGAATGCGTGGAGATTGCAGCCGCAAGATGCACAAAAACACACCGTAAAAGAGCGCAAAAAAGAAAAACAGATGA
CTGCTAATGTTCTTGGTCATAATGTAAACGGGAATGTAAAGGCATCAACTATGAAGGGAGTAAAGAAAGCTGTCAATGCTTCAGCTAATG
ATGCACATCAAGAGGATCCACTGCACGAAACAATGAATGTACCACATCCTGATTTTCACAATTTCGATCACGATAGGAGCGAAAGTTGTT
TTGAACACAATGAAGTCTGGGCTTCATATGATGCTGATGATGGCATGCCCCGTTTCTATGCTCTGATTAACAAAGTCATCTTAAGGGAAC
CATTTAAAGCGAGGCTCAGTTGGCTTAATTCAAAAACGAACACTGAATTTGGTCCAATGGAGTGGGTAGCTTCAGGTTTCTATAAAACTT
CTGGTGAAGTTATGATTGGCAGATATGAAACGGGGXTAAGTCGTGAAATCCTTCTCCCACAAGGGTCAATTGGTAAAAGGGACCTCXGTG
GAACGGTTGTAAAAAATCCCCAAAAGGGGGATGGTTGGGCCCTTTTAAAAAATTTGATTGTTGCATGGAAGCCCAATCCAACTGGATGGA
TGTATTTCCCAAGTTTTAAATGGGCCCTAATTCTTTGGGGAATCCCACtAGGGAACCAGGGGATTTCAATGGCCTCTCTTTAAATCCAAA
TGGGCTGGGTTTAAAAAAACGAATTTTTGGTCCGCAATTTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan