ESTScan Details for Unigene SGN-U344595

Score 
577
Direction 
Forward
Predicted Peptide Sequence 
LTNLQNLVSLNISFNDFYGKLPNSPFFHKLPLSDLTGNQALYISGGDVIQTGPAGHAKTTMKLAXVNPSQYKCCAGSASHLHVDQDENGR
KDGPEVDTWEMTLYQKLDFSIDDIVHNLTSANVIGTGSSGVVYRIMTENGVTLAVKKMWSSEKSGAFGSEIQTLGSIRHKNIVRLLGWAS
NQNMKLLFYDYLPNGSLSSLLHGVGKGAAEWENRFDVVLGVAHALAYLHHDCVPPIMHGDVKAMNVLLGSRMEPYLADFGLAKIVNTDVD
ADLLKESQRPHLAGSYGYMAPEHASMQRITEKSDVSALVGPLGGTNRKHPLDPSCPEGPLNKMGTKSLKNNSSNEXLDPSLKAADPKSMN
GATLPVHSGGNPKLISPIIRNFNPVQGIE
Predicted Coding Sequence 
CTCACGAACCTTCAAAACCTTGTTTCACTCAACATATCATTCAATGACTTCTATGGAAAACTTCCCAATTCTCCATTCTTTCATAAGCTT
CCTTTGAGTGATCTTACTGGAAACCAAGCTCTATACATTTCTGGTGGGGACGTGATCCAAACGGGGCCTGCTGGACATGCCAAAACCACC
ATGAAGCTTGCTXATGTCAATCCTAGTCAGTATAAGTGCTGTGCTGGTTCTGCTAGCCATCTACACGTTGATCAGGATGAGAATGGCCGC
AAAGATGGACCAGAAGTTGATACATGGGAAATGACTCTTTACCAGAAGTTGGACTTTTCAATAGATGACATTGTTCATAATCTAACGTCA
GCTAATGTCATTGGCACTGGGAGCTCTGGGGTTGTATACAGAATAATGACCGAAAATGGGGTGACTTTAGCAGTCAAGAAAATGTGGTCA
TCAGAGAAATCAGGAGCATTTGGTTCAGAAATTCAAACACTTGGTTCAATCCGGCACAAGAACATCGTACGCCTTCTCGGCTGGGCTTCA
AACCAGAACATGAAGCTTCTGTTCTATGACTACCTTCCCAATGGGAGTTTGAGCTCATTACTCCATGGTGTTGGCAAAGGAGCAGCAGAA
TGGGAAAACAGATTTGATGTAGTCCTTGGAGTAGCCCATGCACTTGCATACTTGCATCATGACTGTGTACCCCCTATAATGCATGGAGAT
GTCAAAGCAATGAATGTATTGTTAGGCTCTAGAATGGAGCCTTACCTGGCCGATTTCGGGTTGGCAAAGATTGTCAACACTGATGTTGAT
GCAGACTTGTTAAAGGAGAGTCAAAGGCCTCATCTTGCTGGTTCTTATGGATATATGGCTCCAGAACATGCTTCGATGCAACGGATCACA
GAAAAGAGTGATGTATCAGCTTTGGTGGGTCCTCTTGGAGGTACTAACAGAAAGCATCCCCTGGATCCAAGTTGCCCGGAGGGGCCACTT
AATAAAATGGGTACCAAATCTTTAAAAAACAACTCATCAAATGAAXTTCTTGATCCAAGCTTAAAGGCGGCTGACCCTAAAAGCATGAAT
GGTGCAACATTACCTGTTCATTCGGGGGGGAACCCAAAACTAATATCTCCAATAATAAGGAATTTTAACCCAGTCCAGGGAATCGAATAG
Edits in Original Sequence 
GGCAATTTAGACGTTCTCACGAACCTTCAAAACCTTGTTTCACTCAACATATCATTCAATGACTTCTATGGAAAACTT(5')CTCACGAA
CCTTCAAAACCTTGTTTCACTCAACATATCATTCAATGACTTCTATGGAAAACTTCCCAATTCTCCATTCTTTCATAAGCTTCCTTTGAG
TGATCTTACTGGAAACCAAGCTCTATACATTTCTGGTGGGGACGTGATCCAAACGGGGCCTGCTGGACATGCCAAAACCACCATGAAGCT
TGCTXATGTCAATCCTAGTCAGTATAAGTGCTGTGCTGGTTCTGCTAGCCATCTACACGTTGATCAGGATGAGAATGGCCGCAAAGtATG
GACCAGAAGTTGATACATGGGAAATGACTCTTTACCAGAAGTTGGACTTTTCAATAGATGACATTGTTCATAATCTAACGTCAGCTAATG
TCATTGGCACTGGGAGCTCTGGGGTTGTATACAGAATAATGACCGAAAATGGGGTGACTTTAGCAGTCAAGAAAATGTGGTCATCAGAGA
AATCAGGAGCATTTGGTTCAGAAATTCAAACACTTGGTTCAATCCGGCACAAGAACATCGTACGCCTTCTCGGCTGGGCTTCAAACCAGA
ACATGAAGCTTCTGTTCTATGACTACCTTCCCAATGGGAGTTTGAGCTCATTACTCCATGGTGTTGGCAAAGGAGCAGCAGAATGGGAAA
ACAGATTTGATGTAGTCCTTGGAGTAGCCCATGCACTTGCATACTTGCATCATGACTGTGTACCCCCTATAATGCATGGAGATGTCAAAG
CAATGAATGTATTGTTAGGCTCTAGAATGGAGCCTTACCTGGCCGATTTCGGGTTGGCAAAGATTGTCAACACTGATGTTGATGCAGACT
TGTTAAAGGAGAGTCAAAGGCCTCATCTTGCTGGTTCTTATGGATATATGGCTCCAGAACATGCTTCGATGCAACGGATCACAGAAAAGA
GTGATGTATaCAGCTTTGGTGGGTCCTCTTGGAGGTACTAACAGAAAGCATCCCCTGGATCCAAGTTGCCCGGAGGGGCCACTTAATAAA
ATGGGTACCAAATCTTTAAAAAACAACTCgATCAAATGAAXTTCTTGATCCAAGCTTAAAGGCGGCTGACCCTAAAAGCATGAATGGTGC
AACATTACCTGTTCATTCGGGGGGGAACCCAAAACTAATATCTCCAATAATAAGGAATTTTAACCCAGTCCAGGGAATCGAATAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan