Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U344664

Score 
382
Direction 
Reverse
Predicted Peptide Sequence 
MTVPNSKTLGLSPLLQKGSPHLPPPEGSNSGLQKLHLKMIIMELNESMAINVLVLARTVKLHNARIKRIDGSTKVQKLNLYGNNRGKIEE
MKLDXPKLATKAFAYPIECPSLHFIGEKDPHLLHEEELAGCFVNPVVIHYPEGHKVPNLDAERTEIVIEFINKVKKIKMPLQGNSRL
Predicted Coding Sequence 
ATGACTGTGCCCAATTCTAAAACGTTGGGTTTGAGCCCTTTACTCCAAAAAGGAAGTCCGCACTTACCACCTCCTGAAGGGTCCAATTCT
GGCCTTCAGAAATTACATTTGAAGATGATCATAATGGAACTAAATGAAAGTATGGCCATTAATGTGTTAGTTTTAGCCAGGACAGTTAAA
CTGCACAATGCAAGGATCAAAAGGATAGATGGCTCTACCAAAGTCCAAAAATTAAATTTGTATGGTAATAACAGGGGGAAAATTGAAGAA
ATGAAATTGGATGXTCCAAAGCTTGCTACTAAAGCATTTGCATATCCAATTGAGTGTCCATCTTTGCACTTCATAGGTGAAAAGGATCCT
CATCTACTACATGAAGAAGAACTTGCGGGGTGCTTCGTGAATCCTGTTGTGATTCATTATCCAGAGGGCCACAAAGTACCAAACTTGGAT
GCTGAAAGGACAGAAATTGTGATAGAATTCATCAACAAAGTGAAGAAAATTAAGATGCCATTGCAGGGAAACTCAAGATTGTAA
Edits in Original Sequence 
TGTCCAAAGCTTGCTACTAAAGCATTTGCATATCCAATTGAGTGTCCATCTTTGCACTTCATAGGTGAAAAGGATCCTCATCTACTACAT
GAAGAAGAACTTGCGGGGTGCTTCGTGAATCCTGTTGTGATTCATTATCCAGAGGGCCACAAAGTACCAAACTTGGATGCTGAAAGGACA
GAAATTGTGATAGAATTCATCAACAAAGTGAAGAAAATTAAGATGCCATTGCAGGGAAACTCAAGATTGTA
(5')ATGACTGTGCCCAAT
TCTAAAACGTTGGGTTTGAGCCCTTTACTCCAAAAAGGAAGTCCGCACTTACCACCTCCTGAAGGGTCCAATTCTGGCCTTCAGAAATTA
CATTTGAAGATGATCATAATGtGAACTAAATGAAAGTATGGCCATTAATGTGTTAGTTTTAGCCAGGACAGTTAAACTGCACAATGCAAG
GATCAAAAGGATAGATGGCTCTACCAAAGTCCAAAAATTAAATTTGTATGGTAATAACAGGGGGAAAATTGAAGAAATGAAATTGGATGX
TCCAAAGCTTGCTACTAAAGCATTTGCATATCCAATTGAGTGTCCATCTTTGCACTTCATAGGTGAAAAGGATCCTCATCTACTACATGA
AGAAGAACTTGCGGGGTGCTTCGTGAATCCTGTTGTGATTCATTATCCAGAGGGCCACAAAGTACCAAACTTGGATGCTGAAAGGACAGA
AATTGTGATAGAATTCATCAACAAAGTGAAGAAAATTAAGATGCCATTGCAGGGAAACTCAAGATTGTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan