ESTScan Details for Unigene SGN-U344667

Score 
-341
Direction 
Reverse
Predicted Peptide Sequence 
IRKVRQIGCFVVAKMICGVAPGYXIGNCVVICLWRADSVEYSVAIRGXTFEFKMLXPCSTSVHLARSLATNVGXIHNTEVEMEIYXLEVR
GFTFXKIVTSSXLKSYERIIFVVFPTRELITSLRVIXRGHEGMSVDGYSSSXLSAFLRLAAGDVVGQNTGLKIVFDLSPHPPISHGNFDL
NKGDWSFWAGHGSIHFFQKRYRDAYTVGLLCVQEHPRDRPTMADIILMLNSEMKCSSPKQPTFKFETYLDLDGSAKDNERCSVNEFSASL
SQGR
Predicted Coding Sequence 
ATTAGGAAGGTGAGGCAGATTGGTTGTTTTGTTGTCGCAAAGATGATTTGCGGCGTTGCCCCTGGTTATXTTATTGGTAATTGTGTTGTG
ATTTGTCTTTGGCGTGCCGACTCCGTGGAATATAGTGTGGCTATTCGTGGCXTGACATTTGAGTTCAAGATGCTAGANCCGTGCTCAACG
AGTGTCCACTTAGCTCGCTCACTTGCTACAAATGTCGGATGXATTCATAATACCGAGGTAGAGATGGAAATCTATXTTTTAGAGGTTCGT
GGTTTTACGTTTAXGAAAATAGTTACATCTTCTGXACTAAAATCGTATGAGCGGATAATATTCGTGGTGTTTCCTACTAGAGAGCTGATT
ACTTCTCTACGTGTTATTCXCCGTGGGCATGAAGGTATGTCTGTTGACGGATATTCTTCTTCTXCTCTGTCAGCATTTTTGCGTTTAGCG
GCTGGCGATGTCGTAGGCCAGAATACAGGCCTCAAGATAGTTTTTGATTTATCCCCACACCCCCCAATTAGCCACGGAAATTTTGATCTG
AACAAAGGTGATTGGAGTTTCTGGGCGGGACATGGATCAATTCATTTTTTCCAGAAGAGATACCGCGATGCGTACACXGTTGGCCTTCTT
TGTGTTCAAGAGCATCCTAGGGACCGTCCTACTATGGCTGACATAATTCTCATGCTCAACAGTGAAATGAAATGCTCAAGTCCTAAACAA
CCCACATTTAAGTTTGAAACATACTTGGATCTTGATGGATCAGCAAAAGATAACGAAAGATGTTCTGTCAATGAGTTTAGTGCATCGTTG
TCTCAAGGACGATAG
Edits in Original Sequence 
(5')ATTAGGAAGGTGAGGCAGATgTGGTTGTTTTGTTGTCGCAAAGATGATTTGCGGCGTTGCCCCTGGTTATXTTATTGGTAATTGTG
TTGTGATTTGTCTTTGGCGTGCCGACTCCGTGGAATATAGTGTGGCTATTCGTGGCXTGACATTTGAGTTCAAGATGCTAGANCCGTGCT
CAACGAGTGTCCACTTAGCTCGCTCACTTGCTACAAATGTCGGATGXATTCATAATACCGAGGTAGAGATGGAAATCTATXTTTTAGAGG
TTCGTGGTTTTACGTTTAXGAAAATAGTTACATCTTCTGXACTAAAATCGTATGAGCGGATAATATTCGTGGTGTTTCCTACTAGAGAGC
TGATTACTTCTCTACGTGTTATTCXCCGTGGGCATGAAGGTATGTCTGTTGACGGATATTCTTCTTCTXCTCTGTCAGCATTTTTGCGTT
TAGCGGCTGGCGATGTCGTAGGCCAGAATACAGGCCTCAAGATAcGTTTTTGATTTATCCCCACACCCCCCAATTAGCCACGGAAATTTT
GATCTGAACAAAGGTGATTGGAGTTTCTGGGCGGGACATGGATCAATTCATTTTTTCCAGAAGAGATACCGCGATGCGTACACXGTTGGC
CTTCTTTGTGTTCAAGAGCATCCTAGGGACCGTCCTACTATGGCTGACATAATTCTCATGCTCAACAGTGAAATGAAATGCTCAAGTCCT
AAACAACCCACATTTAAGTTTGAAACATACTTGGATCTTGATGGATCAGCAAAAGATAACGAAAGATGTTCTGTCAATGAGTTTAGTGCA
TCGTTGTCTCAAGGACGATAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan