ESTScan Details for Unigene SGN-U344722

Score 
375
Direction 
Forward
Predicted Peptide Sequence 
LPLVIPXAGRIEPGDPRAAGIRHEAFLYXPALDERGRGSLRRLLIAYARHNPHVGYCQAMNFFAGILLLMMPEENAFWALVGLIDEYFDG
CYSQEMMESQVDQLVFEELVRERFTKLVNHLDYLGMQVAWISGPRFLSIFANVLPWESVFRVWDVLLFEGNPVMIFRTELALMELNGPAV
DTTNDAGDAITFLQSLSGLTFDRSPPCVDSKYGGS
Predicted Coding Sequence 
CTGCCGCTAGTCATCCCAGNGGCTGGCCGAATAGAACCAGGGGACCCCCGGGCTGCAGGAATTCGGCACGAGGCTTTCCTTTACXATCCT
GCACTAGATGAGAGGGGTCGGGGTTCCTTAAGGCGTCTACTTATAGCATATGCTCGACACAATCCACATGTGGGGTATTGCCAGGCAATG
AACTTTTTTGCTGGTATCTTGCTTCTAATGATGCCGGAAGAAAATGCATTCTGGGCATTGGTGGGTCTTATTGATGAATACTTTGACGGC
TGTTACTCACAAGAGATGATGGAATCCCAGGTGGATCAATTGGTGTTTGAGGAGCTGGTGCGCGAAAGGTTTACCAAACTTGTCAATCAT
CTTGATTACTTGGGAATGCAAGTGGCATGGATTTCTGGACCTAGGTTTCTTTCAATTTTTGCAAATGTGCTTCCCTGGGAAAGTGTTTTC
CGAGTTTGGGATGTGCTTCTCTTTGAGGGAAATCCTGTTATGATCTTTCGAACAGAACTTGCTTTGATGGAGTTGAATGGGCCTGCTGTA
GATACAACTAATGATGCTGGGGATGCAATCACCTTTTTGCAATCCCTTTCGGGCTTAACTTTTGATAGGAGCCCACCTTGTGTTGACAGC
AAGTATGGGGGTTCTTAA
Edits in Original Sequence 
(5')CTGCCGCTAGTCATCCCAGNGGCTGGCCGAATAGAACCAGGGGAcCCCCCGGGCTGCAGGAATTCGGCACGAGGCTTTCCTTTACX
ATCCTGCACTAGATGAGAGGGGTCGGGGTTCCTTAAGGCGTCTACTTATAGCATATGCTCGACACAATCCACATGTGGGGTATTGCCAGG
CAATGAACTTTTTTGCTGGTATCTTGCTTCTAATGATGCCGGAAGAAAATGCATTCTGGGCATTGGTGGGTCTTATTGATGAATACTTTG
ACGGCTGTTACTCACAAGAGATGATGGAATCCCAGGTGGATCAATTGGTGTTTGAGGAGCTGGTGCGCGAAAGGTTTACCAAACTTGTCA
ATCATCTTGATTACTTGGGAATGCAAGTGGCATGGATTTCTGGACCTAGGTTTCTTTCAATTTTTGCAAATGTGCTTCCCTGGGAAAGTG
TTTTCCGAGTTTGGGATGTGCTTCTCTTTGAGGGAAATCCTGTTATGATCTTTCGAACAGAACTTGCTTTGATGGAGTTGAATGGGCCTG
CTGTAGATACAACTAATGATGCTGGGGATGCAATCACCTTTTTGCAATCCCTTTCGGGCTTAACTTTTGATAGGAGCCCACCTTGTGTTG
ACAGCAAGTATGGGGGTTCTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan