ESTScan Details for Unigene SGN-U344768

Score 
291
Direction 
Forward
Predicted Peptide Sequence 
MXVMNKKRGAXQTKGLNLMDKTLVVRGARIAFRIWDVGGDHSSFDQIPIACKDSVAILFMFDLTSRSTLNNVISWYTEARKWNQTAIPIL
IGTKFDDFVQLPPDIQWSVVTQARTYAKAMKATLFFSSSTHNINVN
Predicted Coding Sequence 
ATGTAGGTGATGAACAAGAAAAGAGGTGCTXTGCAGACGAAGGGATTGAACTTAATGGATAAAACATTAGTTGTACGAGGTGCACGAATT
GCATTTAGAATATGGGATGTAGGAGGTGATCATAGCTCATTTGATCAGATTCCAATAGCTTGTAAAGATTCTGTTGCCATTCTCTTTATG
TTCGATCTCACTAGCCGGAGTACATTGAACAATGTGATAAGTTGGTATACTGAAGCAAGAAAATGGAATCAGACTGCTATTCCAATACTA
ATTGGGACCAAATTTGATGATTTTGTTCAGCTTCCGCCAGACATTCAATGGTCTGTGGTGACACAGGCAAGGACATATGCAAAGGCAATG
AAAGCAACACTTTTTTTCTCAAGTTCAACACATAACATCAATGTGAATTAG
Edits in Original Sequence 
GATTCAGATTTAGTTACTTTAAAGATCAGTATTTTTGGTGATTGTCAGATTGGTAAAACAAGTTTTGTGATTAAGTATGTAGGTGATGAA
CAAGAAAAGAGGTGCTTGCAGACGAAGGGATTGAACTTAATG
(5')ATGTAGGTGATGAACAAGAAAAGAGGTGCTXTGCAGACGAAGGG
ATTGAACTTAATGGATAAAACATTAGTTGTACGAGGTGCACGAATTGCATTTAGAATATGGGATGTAGGAGGTGATCATAGCTCATTTGA
TCAGATTCCAATAGCTTGTAAAGATTCTGTTGCCATTCTCTTTATGTTCGATCTCACTAGCCGGAGTACATTGAACAATGTGATAAGTTG
GTATACTGAAGCAAGAAAATGGAATCAGACTGCTATTCCAATACTAATTGGGACCAAATTTGATGATTTTGTTCAGCTTCCGCCAGACAT
TCAATGGTCTGTGGTGACACAGGCAAGGACATATGCAAAGGCAATGAAAGCAACACTTTTTTTCTCAAGTTCAACACATAACATCAATGT
GAATTAG(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan