Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U344769

Score 
260
Direction 
Reverse
Predicted Peptide Sequence 
ASKFIQFDHSFNNDEKFRANTLRLSCYLNNAACKLKMGEHQEVSKLCSKVIEYDPCNVKALFRRAQAYLRINELEKAEIDINKALEVDPT
NRDVKVMYKELKNXAEAIYTTRS
Predicted Coding Sequence 
GCCTCGAAATTCATCCAATTCGATCACTCGTTCAATAATGATGAGAAGTTTCGAGCAAATACTTTGCGATTATCGTGTTATTTGAACAAT
GCTGCTTGCAAGTTGAAGATGGGAGAGCATCAAGAAGTCTCAAAACTATGTAGCAAGGTTATAGAGTATGATCCTTGTAATGTCAAAGCT
CTATTCAGAAGGGCTCAAGCATATCTAAGAATCAATGAGCTGGAAAAGGCTGAAATTGATATTAACAAAGCTCTTGAAGTTGATCCAACC
AATAGAGATGTGAAGGTGATGTACAAGGAACTGAAGAATAXAGCAGAAGCAATATACACAACAAGAAGTTGA
Edits in Original Sequence 
ATGTCTCAGTCTCAAACAATTTAAGGAACGACTAATGTTTTTTATGTAAGTTGAAATGTATGTATTGTGAATTCCAGGCCTCGAAATTCA
TCCAATTCGATCACTCGTTCAATAATGATGAGAAGTTTCGAGCAAATACTTTGCGATTATCGTGTTATTTGAACAATGCTGCTTGCAAGT
TGAAGATGGGAGAGCATCAAGAAGTCTCAAAACTATGTAGCAAGGTTATAGAGTATGATCCTTGTAATGTCAAAGCTCTATTCAGAAGGG
CTCAAGCATATCTAAGAATCAATGAGCTGGAAAAGGCTGAAATTGATATTAACAAAGCTCTTGAAGTTGATCCAACCAATAGAGATGTGA
AGGTGATGTACAAGGAACTGAAGAATAAGCAGAAGCAATATACACAACAAGAAGTTGAAATATTTAGCACCATGTTATCAAAATTGAAGA
CAATT
(5')GCCTCGAAATTCATCCAATTCGATCACTCGTTCAATAATGATGAGAAGTTTCGAGCAAATACTTTGCGATTATCGTGTTAT
TTGAACAATGCTGCTTGCAAGTTGAAGATGGGAGAGCATCAAGAAGTCTCAAAACTATGTAGCAAGGTTATAGAGTATGATCCTTGTAAT
GTCAAAGCTCTATTCAGAAGGGCTCAAGCATATCTAAGAATCAATGAGCTGGAAAAGGCTGAAATTGATATTAACAAAGCTCTTGAAGTT
GATCCAACCAATAGAGATGTGAAGGTGATGTACAAGGAACTGAAGAATAXAGCAGAAGCAATATACACAACAAGAAGTTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan