ESTScan Details for Unigene SGN-U344877

Score 
220
Direction 
Forward
Predicted Peptide Sequence 
FSFPPASPXGLXXSDLYEYAYSRWRSHVEAGRSTTMRMPKSKARLVAKGYNQEYGLDYSETFSPVIXAGNHSPGTVTRRRNNWLINQLDV
SNAFLHGMLDETIYMTQPPGYVDPRFPQHVCKLQKSLYGLKQAPRAWYATSENVPPGTRLHVWRTRHEFVYSNSAHGTVILLVYVDDIII
TGSTAALIQDVTRAMHTTFKMKDLGPDIIFWEMKFLDRQQLFFYHSNMLQNCAENWLEKAPSTNTDAVS
Predicted Coding Sequence 
XXTTTCTCTTTTCCCCCAGCCAGCCCCNCNGGGCTTNTTGNGTCGGATCTCTATGAGTACGCATACTCACGGTGGCGCTCCCACGTGGAG
GCAGGCCGATCTACAACTATGCGAATGCCTAAGTCCAAAGCTCGTTTGGTTGCTAAAGGCTACAATCAGGAGTATGGGCTTGATTACTCC
GAGACATTCAGTCCTGTTATTCXGGCAGGAAACCATTCGCCTGGTACTGTCACTCGCCGTCGCAACAATTGGCTCATCAATCAGTTGGAT
GTTTCCAATGCTTTTCTTCATGGCATGCTTGATGAAACAATCTACATGACGCAACCACCGGGCTATGTTGATCCTCGCTTCCCTCAACAT
GTTTGCAAACTCCAGAAGTCTCTGTATGGGCTCAAGCAAGCCCCCCGTGCTTGGTACGCXACGTCTGAAAACGTTCCTCCAGGGACTCGG
CTTCACGTGTGGCGTACACGACACGAGTTTGTTTACTCGAATTCAGCACACGGTACAGTCATTCTTCTTGTCTATGTAGATGATATCATT
ATTACAGGCTCTACTGCAGCTCTCATTCAGGATGTCACTCGAGCTATGCATACTACCTTCAAAATGAAAGACCTTGGGCCCGACATTATT
TTCTGGGAAATGAAGTTTCTCGACAGGCAGCAGCTTTTTTTTTATCATTCAAATATGCTTCAGAACTGTGCAGAAAACTGGCTTGAAAAA
GCACCATCAACCAACACCGATGCGGTTTCTTAA
Edits in Original Sequence 
(5')XXTTTCTCTTTTCCCCCAGCCAGCCCCNCNGGGCTTNTTGNGTCGGATCTCTATGAGTACGCATACTCACGGTGGCGCTCCCACGT
GGAGGCAGGCCGATCTACAACTATGCGAATGCCTAAGTCCAAAGCTCGTTTGGTTGCTAAAGGCTACAATCAGGAGTATGGGCTTGATTA
CTCCGAGACATTCAGTCCTGTTATTCXGGCAGGAAACCATTCGCCTGGTACTGTCACTCGCCGTgCGCAACAATTGGCTCATCAATCAGT
TGGATGTTTCCAATGCTTTTCTTCATGGCATGCTTGATGAAACAATCTACATGACGCAACCACCGGGCTATGTTGATCCTCGCTTCCCTC
AACATGTTTGCAAACTCCAGAAGTCTCTGTATGGGCTCAAGCAAGCCCCCCGTGCTTGGTACGCXACGTCTGAAAACGTTCCTCCAGGGA
CTCGGCTTCACGTGTGGCGTACACGACACGAGTTTGTTTACTCGAtATTCAGCACACGGTACAGTCATTCTTCTTGTCTATGTAGATGAT
ATCATTATTACAGGCTCTACTGCAGCTCTCATTCAGGATGTCACTCGAGCTATGCATACTACCTTCAAAATGAAAGACCTTGGGCCCGtA
CATTATTTTCTGGGAAATGAAGTTTCTCGACAGGCAGCAGCTTTTTTTTTATCATTCAAATATGCTTCAGAACTGTGCAGAAAACTGGCT
TGAAAAAGCACCATCAACCAACACCGATGCGGTTTCTTAA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan