ESTScan Details for Unigene SGN-U345021

Score 
148
Direction 
Forward
Predicted Peptide Sequence 
DAPELVDPRAAGYFKGGGEREKYVKAAFSLASKITPSVVFVDEVDSMLRRRENPGEHESMRKMKNEFMVNWDGLCTKDNERVLGLAATND
TIDLDEALITRLSRTWMANSPDASNREKILRVILAKEELTPNVDLEAISYMTEGDCGSDLKNLCVTTAHCPXYRNVEKEKKEKALAHSDS
LPVPALHYCVDIRALNNDDFKKPLNRFVARFLQNSGNMNGVLQRNELDVEGVLENQKFFNLRHGGAAGYNLLKMAGLEETSLSGEAVKGV
LNICARVIAAIEGCLLLNCMQAEC
Predicted Coding Sequence 
XGGGACGCTCCAGAACTAGTGGATCCCCGGGCTGCAGGTTACTTCAAAGGGGGCGGTGAAAGAGAGAAGTATGTCAAAGCAGCCTTCTCA
TTAGCTAGTAAAATAACGCCTAGTGTCGTGTTTGTTGACGAGGTGGATAGCATGCTACGGAGACGAGAAAATCCTGGTGAGCATGAATCA
ATGCGGAAAATGAAGAATGAATTCATGGTGAATTGGGATGGCTTGTGTACAAAGGACAATGAGCGAGTTCTTGGACTTGCTGCAACTAAT
GACACCATTGACCTTGATGAAGCACTTATTACGAGACTTTCACGGACGTGGATGGCAAACTCGCCAGATGCTTCTAACAGGGAGAAAATT
TTGAGAGTGATATTGGCCAAAGAAGAGTTAACGCCAAATGTTGATCTGGAAGCTATATCATATATGACTGAAGGGGATTGCGGAAGTGAT
TTAAAGAATTTATGTGTGACAACTGCTCATTGCCCAATXTACAGAAATGTTGAGAAAGAGAAAAAGGAAAAAGCATTGGCACATTCAGAT
AGCTTGCCAGTCCCTGCATTGCATTACTGCGTGGACATTCGCGCCCTTAACAATGATGACTTTAAAAAGCCCTTGAACAGGTTTGTGGCT
AGGTTTCTTCAAAATTCTGGCAACATGAATGGAGTTCTTCAGCGGAATGAATTGGATGTGGAAGGTGTTTTAGAGAACCAGAAATTTTTT
AATTTACGTCATGGGGGTGCCGCTGGATATAACCTTTTGAAGATGGCTGGATTGGAAGAAACATCTCTTTCAGGGGAGGCCGTAAAGGGC
GTACTAAATATTTGTGCTCGCGTAATTGCGGCCATCGAAGGTTGCTTGCTCTTGAATTGCATGCAAGCGGAATGCTAA
Edits in Original Sequence 
(5')XGGGACGCTCCAGAACTAGTGGATcCCCCGGGCTGCAGGTTACTTCAAAGGGGtGCGGTGAAAGAGAGAAGTATGTCAAAGCAGCC
TTCTCATTAGCTAGTAAAATAACGCCTAGTGTCGTGTTTGTTGACGAGGTGGATAGCATGCTACGGAGACGAGAAAATCCTGGTGAGCAT
GAATCAATGCGGAAAATGAAGAATGAATTCATGGTGAATTGGGATGGCTTGTGTACAAAGGACAATGAGCGAGTTCTTGGACTTGCTGCA
ACTAATGACACCATTcGACCTTGATGAAGCACTTATTACGAGACTTTCACGGACGTGGATGGCAAACTCGCCAGATGCTTCTAACAGGGA
GAAAATTTTGAGAGTGATATTGGCCAAAGAAGAGTTAACGCCAAATGTTGATCTGGAAGCTATATCATATATGACTGAAGGGGATTGCGG
AAGTGATTTAAAGAATTTATGTGTGACAACTGCTCATTGCCCAATXTACAGAAATGTTGtAGAAAGAGAAAAAGGAAAAAGCATTGGCAC
ATTCAGATAGCTTGCCAGTCCCTGCATTGCATTACTGCGTGGACATTCGCGCCCTTAACAATGATGACTTTAAAtAAGCCCTTGAACAGG
TTTGTGGCTAGGTTTCTTCAAAATTCTGGCAACATGAATGGAGTTCTTCAGCGGAATGAATTGGATGTGGtAAGGTGTTTTAGAGAACCA
cGAAATTTTTTAATTTACGTCATGGGGGTGCCGCTGGATATAACCTTTTGAAGATGGCTGGATTGGAAGAAACATCTCTTTCAGGGGtAG
GCCGTAAAGGGCGTACTAAATATTTGTGCTCGCGTAATTGCGGCCATCGAAGGTTGCTTGCTCTTGAATTGCATGCAAGCGGAATGCTAA
(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan