ESTScan Details for Unigene SGN-U345096

Score 
228
Direction 
Forward
Predicted Peptide Sequence 
AGAPRGGGRSRTSGSPGLQEFGTRPTKGLVPNVVTYTALISGLSKEGRSGEAIRLYNQMIEAGVVPDAAAYSALSFLADNWSSKGPLAND
YHEXIEEYGDSSXDISLPMELGTMQRCRTSYEIAQFSILRPFGIGKYDTQDQVFWDLTKDGKYSNNHNIDQLNMCGSNLEGLWQSELXTG
GIKKSNNSIDKLFVKLDQALSGWEFETRAECSNYRGVQVILQIYYDPTHFRVRLAKLIPKVGSHYFGITLCGKNCEAENLLQPFYWMLGG
PPRWRPLIETDGSLRDNKGTSPWLLPPSNVAAX
Predicted Coding Sequence 
XXAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGCCTACAAAGGGTTTA
GTTCCGAATGTTGTGACTTACACAGCATTGATTTCTGGCTTATCAAAAGAAGGCAGATCAGGTGAAGCCATCCGATTATACAATCAGATG
ATAGAGGCAGGCGTAGTACCCGATGCTGCTGCATACTCTGCACTTAGTTTTTTGGCGGACAACTGGAGTAGCAAAGGTCCTCTAGCCAAT
GATTACCATGAAXACATAGAAGAATACGGAGACTCTAGTAAXGACATTTCATTACCAATGGAACTTGGGACAATGCAAAGATGCAGAACA
TCCTATGAGATAGCACAATTCAGCATATTAAGACCATTTGGAATTGGCAAGTATGACACTCAAGACCAGGTCTTTTGGGACCTCACAAAA
GATGGGAAATATTCCAACAACCACAATATTGATCAGCTCAATATGTGTGGAAGCAATTTGGAAGGCCTCTGGCAATCAGAACTTANCACT
GGTGGAATCAAAAAATCAAATAATTCCATCGACAAGCTATTCGTCAAACTAGACCAGGCCTTATCTGGTTGGGAGTTTGAAACAAGGGCC
GAGTGCAGTAATTATAGAGGCGTXCAAGTAATTCTACAGATATATTATGATCCCACACATTTCAGAGTACGATTGGCTAAGCTTATTCCA
AAAGTGGGTTCACATTACTTTGGGATCACGCTTTGTGGAAAAAATTGTGAAGCTGAAAACCTGCTTCAACCTTTCTATTGGATGCTGGGA
GGTCCTCCAAGATGGCGGCCTTTAATTGAAACTGATGGAAGTTTGAGGGATAATAAAGGCACCTCTCCTTGGCTTCTCCCACCCTCAAAT
GTTGCTGCACXX
Edits in Original Sequence 
(5')XXAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGCCTACAAAGGG
TTTAGTTCCGAATGTTGTGACTTACACAGCATTGATTTCTGGCTTATCAAAAGAAGGCAGATCAGGTGAAGCCATCCGATTATACAATCA
GATGATAGAGGCAGGCGTAGTACCCGATGCTGCTGCATACTCTGCACTTAGTTTTTTGGCGGACAACTGGAGTAGCAAAGGTCCTCTAGC
CAATGATTACCATGAAXACATAGAAGAATACGGAGACTCTAGTAAXGACATTTCATTACCAATGGAACTTGGGACAATGCAAAGATGCAG
AACATCCTATGAGATAGCACAATTCAGCATATTAAGACCATTTGGAATTGGCAAGTATGACACTCAAGACCAGGTCTTTTGGGACCTCAC
AAAAGATGGGAAATATTCCAACAgACCACAATATTGATCAGCTCAATATGTGTGGAAGCAATTTGGAAGGCCTCTGGCAATCAGAACTTA
NCACTGGTGGAATCAAAAAATCAAATAATTCCATCGACAAGCTAgTTCGTCAAACTAGACCAGGCCTTATCTGGTTGGGAGTTTaGAAAC
AAGGGCCGAGTGCAGTAATTATAGAGGCGTXCAAGTAATTCTACAGATATATTATGATCCCACACATTTCAGAGTACGATTGGCTAAGCT
TATTCCAAAAGTGGGTTCACATTACTTTGGGATCACGCTTTGTGGAAAAAATTGTGAAGCTGAAAACCTGCTTCAACCTTTCTATTGGAT
GCTGGGAGGTCCTCCAAGATGGCGGCCTTTAATTGAAtACTGATGGAAGTTTGAgGGGATAATAAAGGCACCTCTCCTTGGCTTCTCCCA
CCCTCAAATGTTGCTGCACXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan