ESTScan Details for Unigene SGN-U345110

Score 
372
Direction 
Forward
Predicted Peptide Sequence 
GXLVKHWSSTAVAAAXRTSGSPGLQEFGTRVDGFRSFSAELKCLLHRPGSNTQPVLIPGLGFRLLRITLASSDSLNSAQSPKASEDFRKR
KRKRKKKIQSLNEREQIADRRHQEVKPFLLKAHEALLEATDLLKVLRNLRNDGCAVGECKELSQETSELSFMELGGVWQAPLYEIVLNYQ
QDDKTLQNGGSPLAQSIEQRETPVFNNLVANEGSYDIEAEIFNHKYIIPKRSXFYMSDMQQIDSLIPTGSDCGFNLIGIDPPWGNGSARQ
KIRVFTFGNPYFLFLPGQQLLSYRLEALVAFGGYX
Predicted Coding Sequence 
XNTGGAANACTTGTAAAACACTGGAGCTCCACCGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACG
AGAGTTGATGGATTCAGGAGTTTCTCAGCTGAACTCAAATGCCTTCTTCATCGACCCGGTTCGAATACTCAACCXGTTCTTATACCCGGT
TTAGGGTTTCGCCTTCTACGTATTACTCTCGCTTCTTCXGATTCCTTGAACTCAGCACAATCTCCAAAAGCTTCCGAAGATTTTAGAAAA
CGAAAACGTAAGAGGAAGAAGAAGATTCAATCTCTAAACGAGCGCGAACAAATAGCCGATCGTCGTCACCAGGAGGTGAAGCCATTCTTG
TTGAAAGCGCATGAAGCTCTGCTCGAAGCTACTGATCTTTTGAAAGTTTTGAGAAATTTGAGGAATGATGGATGTGCCGTGGGGGAATGT
AAGGAGTTGTCGCAAGAAACTAGTGAACTTTCCTTTATGGAGCTTGGAGGTGTTTGGCAAGCTCCATTGTATGAGATCGTTCTTAATTAT
CAGCAAGATGATAAGACTTTGCAAAATGGAGGTTCTCCGCTTGCTCAGAGTATTGAACAAAGAGAGACCCCTGTATTTAATAATCTTGTT
GCCAATGAGGGAAGCTATGATATAGAAGCTGAGATTTTTAATCACAAGTATATTATTCCCAAAAGGAGTTGNTTTTATATGTCTGATATG
CAGCAGATTGACAGCTTAATCCCAACTGGGTCTGATTGTGGCTTCAATCTCATAGGTATAGACCCCCCTTGGGGAAATGGTAGTGCTCGT
CAGAAAATTAGGGTTTTCACTTTTGGCAACCCATACTTCTTATTTCTTCCTGGTCAGCAACTTTTGTCATACCGGTTGGAAGCACTTGTT
GCATTTGGGGGTTACCXX
Edits in Original Sequence 
(5')XNTGGAANACTTGTAAAACACTGGAGCTCCACCGCGGTGGCGGCCGCTXCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGG
CACGAGAGTTGATGGATTCAGGAGTTTCTCAGCTGAACTCAAATGCCTTCTTCATCGACCCGGTTCGAATACTCAACCXGTTCTTATACC
CGGTTTAGGGTTTCGCCTTCTACGTATTACTCTCGCTTCTTCXGATTCCTTGAACTCAGCACAATCTCCAAAAGCTTCCGAAGATTTTAG
AAAACGAAAACGTAAGAGGAAGAAGAAGATTCAATCTCTAAACGAGCGCGAACAAATAGCCGATCGTCGTCACCAGGAGGTGAAGCCATT
CTTGTTGAAAGCGCATGAAGCTCTGCTCGAAGCTACTGATCTTTTGAAAGTTTTGAGAAATTTGAGGAATGATGGATGTGCCGTGGGGGA
ATGTAAGGAGTTGTCGCAAGAAACTAGTGAACTTTCCTTTATGGAGCTTGGAGGTGTTTGGCAAGCTCCATTGTATGAGATCGTTCTTAA
TTATCAGCAAGATGATAAGACTTTGCAAAATGGAGGTTCTCCGCTTGCTCAGAGTATTGAACAAAGAGAGACCCCTGTATTTAATAATCT
TGTTGCCAATGAGGGAAGCTATGATATAGAAGCTGAGATTTTTAATCACAAGTATATTATTCCCAAAAGGAGTTGNTTTTATATGTCTGA
TATGCAGCAGATTGACAGCTTAATCCCAACTGGGTCTGATTGTGGCTTCAATCTCATAGGTATAGACCCCCCTTGGGGAAATGGTAGTGC
TCGTCAGAAAATTAGGGTTTTCACTTTTGGCtAACCCATACTTCTTATTTCTTCCTGGTCAGCAACTTTTGTCATACCGGTTGGAAGCAC
TTGTTGCATTTGGGGGTTACCXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan