ESTScan Details for Unigene SGN-U345118

Score 
386
Direction 
Forward
Predicted Peptide Sequence 
LAGAPRGGGRSITSGSPGLQEFGXEAQDEIEDLSLSLPTVGSMQIAGSNGFGHNIEFMSQAYLRNRSSEIDIEVEHDTSIAHIDQPLPIF
LKFANVEYKVKTNQAFSNNPVKAVVSKVASQFENDNYKHILKGITGSISPGEILALMGPSGSGKTTLLKILGGRLHENVKGTVTYNDIPY
SPALKRRVGFVTQDDVLFPQLTVEETLVFAAFLRLPCKMSRRQKYERVEVIIKELGLESTLXSFHVLEYSLIATTVATVPREFLNVDVVI
QEXGGGLVKGVSVGXKKRASIGHENLGDPFSLLVEEQLPALI
Predicted Coding Sequence 
XXTTTAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTATAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCXACGAGGCACAAGATGAA
ATCGAGGACTTGTCGTTGTCCCTTCCAACTGTTGGCTCAATGCAGATTGCTGGAAGTAACGGTTTTGGACATAACATAGAGTTCATGTCT
CAAGCTTATCTTAGAAACAGAAGCTCTGAAATTGATATAGAAGTTGAACATGATACGTCTATCGCTCATATAGATCAACCTCTTCCCATA
TTCCTCAAGTTTGCAAATGTGGAGTATAAGGTGAAGACTAATCAAGCTTTCTCCAACAATCCTGTCAAGGCAGTTGTCTCAAAGGTAGCT
TCTCAGTTTGAAAATGATAATTACAAACATATACTCAAAGGTATAACGGGAAGCATTAGTCCCGGTGAAATTCTTGCCTTAATGGGACCT
TCGGGCAGTGGAAAAACGACTTTGTTAAAGATACTGGGTGGAAGATTGCACGAAAATGTCAAAGGAACCGTCACTTACAATGACATTCCA
TATAGTCCAGCTCTGAAAAGAAGGGTGGGTTTCGTGACACAAGATGATGTGCTTTTCCCACAATTGACGGTTGAGGAAACTTTAGTTTTT
GCTGCATTCTTAAGACTTCCATGCAAGATGAGTCGACGTCAGAAGTATGAAAGAGTAGAAGTGATTATTAAGGAATTAGGCCTTGAAAGT
ACTTTGNTATCCTTTCATGTACTTGAGTACTCACTAATAGCAACTACCGTTGCAACTGTTCCTCGTGAATTTCTTAATGTAGATGTCGTC
ATACAAGAAXTAGGTGGAGGACTTGTAAAAGGGGTTTCTGTTGGAGAXAAGAAAAGAGCTAGCATAGGTCATGAAAATCTTGGTGATCCT
TTCTCTCTCTTGGTCGAAGAACAACTTCCAGCCTTGATT
Edits in Original Sequence 
(5')XXTTTAGCTGGAGCTCCCCGCGGTGGCGGCCGCTCTATAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCXACGAGGCACAAGA
TGAAATCGAGGACTTGTCGTTGTCCCTTCCAACTGTTGGCTCAATGCAGATTGCTGGAAGTAACGGTTTTGGACATAACATAGAGTTCAT
GTCTCAAGCTTATCTTAGAAACAGAAGCTCTGAAATTGATATAGAAGTTGAACATGATACGTCTATCGCTCATATAGATCAACCTCTTCC
CATATTCCTCAAGTTTGCAAATGTGGAGTATAAGGTGAAGACTAATCAAGCTTTCTCCAACAATCCTGTCAAGGCAGTTGTCTCAAAGGT
AGCTTCTCAGTTTGAAAATGATAATTACAAACATATACTCAAAGGTATAACGGGAAGCATTAGTCCCGGTGAAATTCTTGCCTTAATGGG
ACCTTCGGGCAGTGGAAAAACGACTTTGTTAAAGATACTGGGTGGAAGATTGCACGAAAATGTCAAAGGAACCGTCACTTACAATGACAT
TCCATATAGTCCAGCTCTGAAAAGAAGGGTGGGTTTCGTGACACAAGATGATGTGCTTTTCCCACAATTGACGGTTGAGGAAACTTTAGT
TTTTGCTGCATTCTTAAGACTTCCATGCAAGATGAGTCGACGTCAGAAGTATGAAAGAGTAGAAGTGATTATTAAGGAATTAGGCCTTGA
AAGTACTTTGNTATCCTTTCATGTACTTGAGTACTCACTAATAGCAACTACCGTTGCAACTGTTCaCTCGTGAATTTCTTAATGTAGATG
TCGTCATACAAGAAXTAGGTGGAGGACTTGTAAAAGGGGTTTCTGTTGGAGAXAAGAAAAGAGCTAGCATAGGTCATGAAAATCTTGGTG
ATCCTTTCTCTCTCTTGGTCGAAGAACAACTTCCAGCCTTGATT(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan