ESTScan Details for Unigene SGN-U345168

Score 
-169
Direction 
Forward
Predicted Peptide Sequence 
MSHGANYMKLQISMVKIMAYALALIIMNDVSHGANCMMLQIGRTKIMVYALALEGGPXYPIRPIVSRITIHWPSFYNVVTGKTLALPNXN
RLAAHPPFASWRNSEEARTDRPSQQLRTLNGEWQIVSVNILLKFAQILVKSAYFLTNTPKSVKSLINQKNKPDRVECWSILNKSPLYRTG
LNVKGENPFX
Predicted Coding Sequence 
ATGTCTCATGGTGCAAATTATATGAAGCTTCAAATCAGCATGGTGAAAATTATGGCATATGCTCTAGCGCTCATCATAATGAATGATGTG
TCTCACGGTGCCAATTGCATGATGCTTCAAATTGGCAGGACAAAAATTATGGTATATGCTCTAGCGCTCGAGGGGGGGCCCGXGTACCCA
ATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAAAACCCTGGCGTTACCCAACTTXAAT
CGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCCTTCCCAACAGTTGCGCACCCTGAAT
GGCGAATGGCAAATTGTAAGCGTTAATATTTTGCTAAAATTCGCGCAAATTCTTGTTAAATCAGCTTATTTTTTAACCAATACGCCGAAA
TCGGTAAAATCCCTTATAAATCAAAAGAATAAACCAGATAGGGTTGAGTGTTGGTCCATTTTGAACAAGAGTCCACTTTATAGAACTGGT
CTCAACGTCAAGGGCGAAAACCCGTTTTXX
Edits in Original Sequence 
AGTAATGAGCATAACGGCCCTATTGTTCCGATGGAGAGAAGAACCTATGATTAGCTTTTCGGGAAATTTCCAAACGAACAATTTCAACGA
AATCTTTCAATTTCTTATTTTACTATGTTCACCATGATGAATGATATGTCTCATGGTGCAAATTATATGAAGCTTCAAATCAGCATGGTG
AAAATTATGGCATATGCTCTAGCGCTCATCATAATGAATGATGTGTCTCACGGTGCCAATTGCATGATGCTTCAAATTGGCAGGACAAAA
ATTATGGTATATGCTCTAGCG
(5')ATGTCTCATGGTGCAAATTATATGAAGCTTCAAATCAGCATGGTGAAAATTATGGCATATGCTCT
AGCGCTCATCATAATGAATGATGTGTCTCACGGTGCCAATTGCATGATGCTTCAAATTGGCAGGACAAAAATTATGGTATATGCTCTAGC
GCTCGAGGGGGGGCCCGXGTACCCAATTCGCCCTATAGTGAGTCGTATTACAATTCACTGGCCGTCGTTTTACAACGTCGTGACTGGGAA
AACCCTGGCGTTACCCAACTTXAATCGCCTTGCAGCACATCCCCCTTTCGCCAGCTGGCGTAATAGCGAAGAGGCCCGCACCGATCGCCC
TTCCCAACAGTTGCGCACCCTGAATGGCGAATGGCAAATTGTAAGCGTTAATATTTTGCTAAAATTCGCGCtAAATTCTTGTTAAATCAG
CTTATTTTTTAACCAATACGCCGAAATCGGTAAAATCCCTTATAAATCAAAAGAATAAACCgAGATAGGGTTGAGTGTTGGTCCATTTTG
AACAAGAGTCCACTTTATAGAACgTGGTCTCAACGTCAAGGGCGAAAACCCGTTTTXX(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan