Notice: Due to a regional power outage, SGN was briefly unavailable on Saturday, Feb 4. We apologize for the inconvenience.

ESTScan Details for Unigene SGN-U345208

Score 
576
Direction 
Forward
Predicted Peptide Sequence 
WRPKLELHRGGGRSRTSGSPGLQEFGRGTIPASFSNLSALSTLDLKSNLLDSQIPDTMYRMRNLSVLDLSNNKFIGHIPATIGNISRLTS
LELSGNNFSGEIPDSLVSLANLTSLDVSYNNLSGIVPSLLSRKFNSSAFVGNLELCGYSPSTPCASPPPQTVPSPVSGVVKPHRHRKLST
KDVILIASGALLVGLLLLCCMLLCCLIRKKANSRAKNGGKTGGLTTTTGRSAKSVPXLVEGLNCNKGTGGKAIHFHGPFVVATQPIVCAT
GEI
Predicted Coding Sequence 
XNTTGGAGACCAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCAGAGGAACT
ATTCCTGCTAGTTTCTCAAACCTTTCAGCTCTTTCTACTTTGGATTTAAAGAGTAATCTTTTGGATAGCCAAATCCCAGATACTATGTAT
AGAATGAGAAACCTGTCAGTGCTGGATTTGAGTAACAACAAATTCATTGGTCATATTCCAGCTACTATTGGAAATATTTCTAGGCTCACC
TCACTTGAATTGTCTGGAAACAATTTCAGTGGTGAAATTCCAGACTCTCTTGTTTCTTTGGCAAATCTGACTTCTTTGGATGTGTCTTAT
AACAATCTTTCTGGGATTGTTCCATCTCTTCTTTCTAGAAAGTTCAATTCAAGTGCTTTTGTTGGAAATCTAGAGCTTTGTGGATATAGT
CCCTCAACTCCATGTGCTTCACCACCCCCTCAAACTGTTCCTTCTCCTGTTAGTGGGGTTGTCAAGCCTCACCGTCATCGTAAACTTAGT
ACCAAAGATGTCATTCTCATAGCATCAGGTGCTCTTCTAGTTGGTCTGCTTCTTTTGTGCTGCATGTTACTTTGCTGCTTGATTAGGAAA
AAGGCAAATTCGAGAGCGAAAAATGGTGGCAAAACTGGTGGCCTAACTACCACTACGGGGAGAAGTGCCAAGTCAGTTCCTXTGCTGGTA
GAGGGGCTGAATTGTAATAAGGGAACTGGTGGGAAAGCTATCCATTTCCATGGGCCCTTTGTGGTTGCAACACAACCAATTGTGTGTGCC
ACTGGAGAAATA
Edits in Original Sequence 
(5')XNTTGGAGACCAAAGCTGGAGCTCCACCGCGGTGGCGGCCGCTCTAGAACTAGTGGATCCCCCGGGCTGCAGGAATTCGGCAcGAG
GAACTATTCCTGCTAGTTTCTCAAACCTTTCAGCTCTTTCTACTTTGGATTTAAAGAGTAATCTTTTGGATAGCCAAATCCCAGATACTA
TGTATAGAATGAGAAACCTGTCAGTGCTGGATTTGAGTAACAACAAATTCATTGGTCATATTCCAGCTACTATTGGAAATATTTCTAGGC
TCACCTCACTTGAATTGTCTGGAAACAATTTCAGTGGTGAAATTCCAGACTCTCTTGTTTCTTTGGCAAATCTGACTTCTTTGGATGTGT
CTTATAACAATCTTTCTGGGATTGTTCCATCTCTTCTTTCTAGAAAGTTCAATTCAAGTGCTTTTGTTGGAAATCTAGAGCTTTGTGGAT
ATAGTCCCTCAACTCCATGTGCTTCACCACCCCCTCAAACTGTTCCTTCTCCTGTTAGTGGGGTTGTCAAGCCTCACCGTCATCGTAAAC
TTAGTACCAAAGATGTCATTCTCATAGCATCAGGTGCTCTTCTAGTTGGTCTGCTTCTTTTGTGCTGCATGTTACTTTGCTGCTTGATTA
GGAAAAAGGCAAATTCGAGAGCGAAAAATGGTGGCAAAACTGGTGGCCTAACTACCACTACGGGGAGAAGTGCCAAGTCAGTTCCTXTGC
TGGTAGAGGGGCTGAATTGTAATAAGGtGAACTGGTGGGAAAGCTATCCATTTCCATGGGCCCTTTGTGGTTGCAACACAACCAATTGTG
TGTGCCACTGGAGAAATA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan