ESTScan Details for Unigene SGN-U345220

Score 
381
Direction 
Forward
Predicted Peptide Sequence 
IXXXXGXXXXXXXDYNAGAHRGGGRSRTSGSPGLQEFGTRVPSNPMIDGLKRMEVVFCVRLLREQFLLCLKIGRDLIRLLQDLVHIPEFK
AIWRDLLLNPRHFGVDGFKDISQIYHTKTPSSYFLLRVTPEMETKLRFLLTHVKLGNQKRYQVWFAKKFLGVPGSEVILTDIVGLYAVQF
IHPVKLCNQISYPDGLDWLAIDVVQEELCPSKLEARIVYDWLFYDETTDNELTFEPAILLIVNSLPNFIEVTRTLSRIPTKWGDNFYFER
REKSPQG
Predicted Coding Sequence 
XXNATTGANNACXCNNTTGGAAANGNCNNNNNNNNNNTNNTTGATTACAATGCTGGAGCTCACCGCGGTGGCGGCCGCTCTAGAACTAGT
GGATCCCCCGGGCTGCAGGAATTCGGCACGAGGGTTCCAAGTAATCCAATGATTGATGGATTGAAGAGAATGGAGGTTGTATTCTGTGTT
CGACTTTTGAGGGAACAATTTCTTTTGTGTTTGAAGATAGGGAGGGACTTAATTAGGCTTTTGCAAGACTTGGTTCATATACCTGAGTTT
AAAGCCATATGGAGAGACTTGTTATTGAATCCAAGACACTTTGGGGTGGATGGATTTAAAGATATTTCACAAATTTACCACACAAAAACT
CCAAGTTCATACTTTTTGCTTCGAGTAACTCCTGAAATGGAAACTAAATTGAGGTTTTTGCTTACACATGTCAAGTTGGGTAACCAAAAG
AGGTACCAGGTTTGGTTCGCTAAGAAGTTCCTTGGAGTACCTGGGAGTGAAGTCATTTTAACCGACATTGTTGGTTTATATGCTGTTCAG
TTCATCCATCCAGTGAAATTATGCAACCAGATATCTTACCCAGATGGGCTTGATTGGTTGGCTATTGACGTCGTGCAAGAAGAGTTATGT
CCCAGCAAACTTGAAGCTCGCATTGTTTATGATTGGCTTTTCTATGATGAAACCACTGATAATGAATTGACATTTGAGCCTGCNATTCTT
TTGATTGTGAACTCTTTACCCAATTTTATTGAAGTTACCCGTACTCTTTCTCGAATTCCTACTAAATGGGGTGACAACTTTTATTTTGAA
AGGAGGGAAAAGTCTCCCCAAGGGTGA
Edits in Original Sequence 
(5')XXNATTGANNACXCNNTTGGAAANGNCNNNNNNNNNNTNNTTGATTACAATGCTGGAGCTcCACCGCGGTGGCGGCCGCTCTAGAA
CTAGTGGATCCCCCGGGCTGCAGGAATTCGGCACGAGGGTTCCAAGTAATCCAATGATTGATGGATTGAAGAGAATGGAGGTTGTATTCT
GTGTTCGACTTTTGAGGGAACAATTTCTTTTGTGTTTGAAGATAGGGAGGGACTTAATTAGGCTTTTGCAAGACTTGGTTCATATACCTG
AGTTTAAAGCCATATGGAGAGACTTGTTATTGAATCCAAGACACTTTGGGGTGGATGGATTTAAAGATATTTCACAAATTTACCACACAA
AAACTCCAAGTTCATACTTTTTGCTTCGAGTAACTCCTGAAATGGAAACTAAATTGAGGTTTTTGCTTACACATGTCAAGTTGGGTAACC
AAAAGAGGTACCAGGTTTGGTTCGCTAAGAAGTTCCTTGGAGTACCTGGGAGTGAAGTCATTTTAACCGACATTGTTaGGTTTATATGCT
GTTCAGTTCATCCATCCAGTGAAATTATGCAACCAGATATCTTACCCAGATGGGCTgTGATTGGTTGGCTATTGACGTCGTGCAAGAAGA
GTTATGTCCCAGCAAACTTGAAGCTCGCATTGTTTATGATTGGCTTTTCTATGATGAAACCACTGATAATGtAATTGACATTTGAGCCTG
CNATTCTTTTGATTGTGAACTCTTTACCCAATTTTATTGAAGTTACCCGTACTCTTTCTCGAATTCCTACTAAATGtGGGTGACAACTTT
TATTTTGAAAGGAGGGAAAAGTCTCCCCAAGGGTGA(3')

ACTGX -- Inserted by ESTScan
actgn -- Deleted by ESTScan
ACTGN -- UTR Deleted by ESTScan